PDB entry 3ujt

View 3ujt on RCSB PDB site
Description: Structure of the Fab fragment of Ab-52, an antibody that binds the O-antigen of Francisella tularensis
Class: immune system
Keywords: immunoglobulin, immune system, O-antigen
Deposited on 2011-11-08, released 2012-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ab-52 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UJT (0-212)
  • Chain 'I':
    Compound: Ab-52 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UJT (0-212)
  • Chain 'L':
    Compound: Ab-52 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UJT (0-216)
    Domains in SCOPe 2.07: d3ujtl1, d3ujtl2
  • Chain 'M':
    Compound: Ab-52 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UJT (0-216)
    Domains in SCOPe 2.07: d3ujtm1, d3ujtm2
  • Heterogens: TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ujtL (L:)
    divmtqspsslamsvgqkvtmsckssqsllnssnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedladyfcqqhystpftfgsgtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ujtM (M:)
    divmtqspsslamsvgqkvtmsckssqsllnssnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedladyfcqqhystpftfgsgtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr