PDB entry 3ujp

View 3ujp on RCSB PDB site
Description: Structure of MntC protein at 2.7A
Class: metal binding protein
Keywords: manganese binding protein, METAL BINDING PROTEIN
Deposited on 2011-11-08, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mn transporter subunit
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: mntC, sll1598, SYNGTS_1343
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ujpa_
  • Chain 'B':
    Compound: Mn transporter subunit
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: mntC, sll1598, SYNGTS_1343
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ujpb_
  • Chain 'C':
    Compound: Mn transporter subunit
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: mntC, sll1598, SYNGTS_1343
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ujpc_
  • Heterogens: MN, ZN, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ujpA (A:)
    gcgtaevttsnapseevtavttevqgeteekkkvlttftvladmvqnvagdklvvesitr
    igaeihgyeptpsdivkaqdadlilyngmnlerwfeqflgnvkdvpsvvltegiepipia
    dgpytdkpnphawmsprnalvyvenirqafveldpdnakyynanaavyseqlkaidrqlg
    adleqvpanqrflvscegafsylardygmeeiymwpinaeqqftpkqvqtvieevktnnv
    ptifcestvsdkgqkqvaqatgarfggnlyvdslsteegpvptfldlleydarvitngll
    agtnaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ujpA (A:)
    teekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyn
    gmnlerwfeqflgnvkdvpsvvltegiepipiadgpytdkpnphawmsprnalvyvenir
    qafveldpdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardy
    gmeeiymwpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfgg
    nlyvdslsteegpvptfldlleydarvitnglla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ujpB (B:)
    gcgtaevttsnapseevtavttevqgeteekkkvlttftvladmvqnvagdklvvesitr
    igaeihgyeptpsdivkaqdadlilyngmnlerwfeqflgnvkdvpsvvltegiepipia
    dgpytdkpnphawmsprnalvyvenirqafveldpdnakyynanaavyseqlkaidrqlg
    adleqvpanqrflvscegafsylardygmeeiymwpinaeqqftpkqvqtvieevktnnv
    ptifcestvsdkgqkqvaqatgarfggnlyvdslsteegpvptfldlleydarvitngll
    agtnaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ujpB (B:)
    ekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngm
    nlerwfeqflgnvkdvpsvvltegiepipitdkpnphawmsprnalvyvenirqafveld
    pdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardygmeeiym
    wpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnlyvdsl
    steegpvptfldlleydarvitnglla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ujpC (C:)
    gcgtaevttsnapseevtavttevqgeteekkkvlttftvladmvqnvagdklvvesitr
    igaeihgyeptpsdivkaqdadlilyngmnlerwfeqflgnvkdvpsvvltegiepipia
    dgpytdkpnphawmsprnalvyvenirqafveldpdnakyynanaavyseqlkaidrqlg
    adleqvpanqrflvscegafsylardygmeeiymwpinaeqqftpkqvqtvieevktnnv
    ptifcestvsdkgqkqvaqatgarfggnlyvdslsteegpvptfldlleydarvitngll
    agtnaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ujpC (C:)
    eekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyng
    mnlerwfeqflgnvkdvpsvvltegiepipiadgpytdkpnphawmsprnalvyvenirq
    afveldpdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardyg
    meeiymwpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggn
    lyvdslsteegpvptfldlleydarvitngll