PDB entry 3uj2

View 3uj2 on RCSB PDB site
Description: crystal structure of an enolase from anaerostipes caccae (efi target efi-502054) with bound mg and sulfate
Class: lyase
Keywords: Enolase, enzyme function initiative, EFI, LYASE
Deposited on 2011-11-07, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase 1
    Species: Anaerostipes caccae [TaxId:411490]
    Gene: eno1, ANACAC_00540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uj2a1, d3uj2a2
  • Chain 'B':
    Compound: enolase 1
    Species: Anaerostipes caccae [TaxId:411490]
    Gene: eno1, ANACAC_00540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uj2b1, d3uj2b2
  • Chain 'C':
    Compound: enolase 1
    Species: Anaerostipes caccae [TaxId:411490]
    Gene: eno1, ANACAC_00540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uj2c1, d3uj2c2
  • Chain 'D':
    Compound: enolase 1
    Species: Anaerostipes caccae [TaxId:411490]
    Gene: eno1, ANACAC_00540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uj2d1, d3uj2d2
  • Chain 'E':
    Compound: enolase 1
    Species: Anaerostipes caccae [TaxId:411490]
    Gene: eno1, ANACAC_00540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uj2e1, d3uj2e2
  • Chain 'F':
    Compound: enolase 1
    Species: Anaerostipes caccae [TaxId:411490]
    Gene: eno1, ANACAC_00540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uj2f1, d3uj2f2
  • Chain 'G':
    Compound: enolase 1
    Species: Anaerostipes caccae [TaxId:411490]
    Gene: eno1, ANACAC_00540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uj2g1, d3uj2g2
  • Chain 'H':
    Compound: enolase 1
    Species: Anaerostipes caccae [TaxId:411490]
    Gene: eno1, ANACAC_00540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uj2h1, d3uj2h2
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uj2A (A:)
    mhhhhhhssgvdlgtenlyfqsmnyleiekvigreiidsrgnptveaevylaggvtgrgt
    apsgastgefealelrdgdkgrfggkgvtkavqninteiseilsgmdasdiyavdramid
    adgtkdkskfganavlavsiacakaaaaalgvplyrflgglnanrlpvpmmnilnggaha
    antvdvqefmimpvgaesfrealrqctevfhalagllkskglatsvgdeggfapdlasde
    eaieyileavklagyepgrdfvlamdaassewkgekkgeyilpkckrkfaseelvahwks
    lcerypivsiedgldeedwegwqymtrelgdkiqlvgddlfvtnterlnkgikercgnsi
    liklnqigtvsetleaikmahkagytavvshrsgetedttiadlavalntgqiktgapsr
    servakynqllrieeelgdsavypgfttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uj2A (A:)
    nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
    gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
    aaalgvplyrflgglnanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqc
    tevfhalagllkskglatsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamd
    aassewkgekkgeyilpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymt
    relgdkiqlvgddlfvtnterlnkgikercgnsiliklnqigtvsetleaikmahkagyt
    avvshrsgetedttiadlavalntgqiktgapsrservakynqllrieeelgdsavypgf
    ttf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uj2B (B:)
    mhhhhhhssgvdlgtenlyfqsmnyleiekvigreiidsrgnptveaevylaggvtgrgt
    apsgastgefealelrdgdkgrfggkgvtkavqninteiseilsgmdasdiyavdramid
    adgtkdkskfganavlavsiacakaaaaalgvplyrflgglnanrlpvpmmnilnggaha
    antvdvqefmimpvgaesfrealrqctevfhalagllkskglatsvgdeggfapdlasde
    eaieyileavklagyepgrdfvlamdaassewkgekkgeyilpkckrkfaseelvahwks
    lcerypivsiedgldeedwegwqymtrelgdkiqlvgddlfvtnterlnkgikercgnsi
    liklnqigtvsetleaikmahkagytavvshrsgetedttiadlavalntgqiktgapsr
    servakynqllrieeelgdsavypgfttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uj2B (B:)
    nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
    gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
    aaalgvplyrflgglnanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqc
    tevfhalagllkskglatsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamd
    aassewkgekkgeyilpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymt
    relgdkiqlvgddlfvtnterlnkgikercgnsiliklnqigtvsetleaikmahkagyt
    avvshrsgetedttiadlavalntgqiktgapsrservakynqllrieeelgdsavypgf
    ttf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uj2C (C:)
    mhhhhhhssgvdlgtenlyfqsmnyleiekvigreiidsrgnptveaevylaggvtgrgt
    apsgastgefealelrdgdkgrfggkgvtkavqninteiseilsgmdasdiyavdramid
    adgtkdkskfganavlavsiacakaaaaalgvplyrflgglnanrlpvpmmnilnggaha
    antvdvqefmimpvgaesfrealrqctevfhalagllkskglatsvgdeggfapdlasde
    eaieyileavklagyepgrdfvlamdaassewkgekkgeyilpkckrkfaseelvahwks
    lcerypivsiedgldeedwegwqymtrelgdkiqlvgddlfvtnterlnkgikercgnsi
    liklnqigtvsetleaikmahkagytavvshrsgetedttiadlavalntgqiktgapsr
    servakynqllrieeelgdsavypgfttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uj2C (C:)
    nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
    gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
    aaalgvplyrflgglnanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqc
    tevfhalagllkskglatsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamd
    aassewkgekkgeyilpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymt
    relgdkiqlvgddlfvtnterlnkgikercgnsiliklnqigtvsetleaikmahkagyt
    avvshrsgetedttiadlavalntgqiktgapsrservakynqllrieeelgdsavypgf
    ttf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uj2D (D:)
    mhhhhhhssgvdlgtenlyfqsmnyleiekvigreiidsrgnptveaevylaggvtgrgt
    apsgastgefealelrdgdkgrfggkgvtkavqninteiseilsgmdasdiyavdramid
    adgtkdkskfganavlavsiacakaaaaalgvplyrflgglnanrlpvpmmnilnggaha
    antvdvqefmimpvgaesfrealrqctevfhalagllkskglatsvgdeggfapdlasde
    eaieyileavklagyepgrdfvlamdaassewkgekkgeyilpkckrkfaseelvahwks
    lcerypivsiedgldeedwegwqymtrelgdkiqlvgddlfvtnterlnkgikercgnsi
    liklnqigtvsetleaikmahkagytavvshrsgetedttiadlavalntgqiktgapsr
    servakynqllrieeelgdsavypgfttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uj2D (D:)
    nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
    gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
    aaalgvplyrflgglnanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqc
    tevfhalagllkskglatsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamd
    aassewkgekkgeyilpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymt
    relgdkiqlvgddlfvtnterlnkgikercgnsiliklnqigtvsetleaikmahkagyt
    avvshrsgetedttiadlavalntgqiktgapsrservakynqllrieeelgdsavypgf
    ttf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3uj2E (E:)
    mhhhhhhssgvdlgtenlyfqsmnyleiekvigreiidsrgnptveaevylaggvtgrgt
    apsgastgefealelrdgdkgrfggkgvtkavqninteiseilsgmdasdiyavdramid
    adgtkdkskfganavlavsiacakaaaaalgvplyrflgglnanrlpvpmmnilnggaha
    antvdvqefmimpvgaesfrealrqctevfhalagllkskglatsvgdeggfapdlasde
    eaieyileavklagyepgrdfvlamdaassewkgekkgeyilpkckrkfaseelvahwks
    lcerypivsiedgldeedwegwqymtrelgdkiqlvgddlfvtnterlnkgikercgnsi
    liklnqigtvsetleaikmahkagytavvshrsgetedttiadlavalntgqiktgapsr
    servakynqllrieeelgdsavypgfttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uj2E (E:)
    nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
    gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
    aaalgvplyrflgglnanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqc
    tevfhalagllkskglatsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamd
    aassewkgekkgeyilpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymt
    relgdkiqlvgddlfvtnterlnkgikercgnsiliklnqigtvsetleaikmahkagyt
    avvshrsgetedttiadlavalntgqiktgapsrservakynqllrieeelgdsavypgf
    ttf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3uj2F (F:)
    mhhhhhhssgvdlgtenlyfqsmnyleiekvigreiidsrgnptveaevylaggvtgrgt
    apsgastgefealelrdgdkgrfggkgvtkavqninteiseilsgmdasdiyavdramid
    adgtkdkskfganavlavsiacakaaaaalgvplyrflgglnanrlpvpmmnilnggaha
    antvdvqefmimpvgaesfrealrqctevfhalagllkskglatsvgdeggfapdlasde
    eaieyileavklagyepgrdfvlamdaassewkgekkgeyilpkckrkfaseelvahwks
    lcerypivsiedgldeedwegwqymtrelgdkiqlvgddlfvtnterlnkgikercgnsi
    liklnqigtvsetleaikmahkagytavvshrsgetedttiadlavalntgqiktgapsr
    servakynqllrieeelgdsavypgfttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uj2F (F:)
    nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
    gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
    aaalgvplyrflgglnanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqc
    tevfhalagllkskglatsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamd
    aassewkgekkgeyilpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymt
    relgdkiqlvgddlfvtnterlnkgikercgnsiliklnqigtvsetleaikmahkagyt
    avvshrsgetedttiadlavalntgqiktgapsrservakynqllrieeelgdsavypgf
    ttf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3uj2G (G:)
    mhhhhhhssgvdlgtenlyfqsmnyleiekvigreiidsrgnptveaevylaggvtgrgt
    apsgastgefealelrdgdkgrfggkgvtkavqninteiseilsgmdasdiyavdramid
    adgtkdkskfganavlavsiacakaaaaalgvplyrflgglnanrlpvpmmnilnggaha
    antvdvqefmimpvgaesfrealrqctevfhalagllkskglatsvgdeggfapdlasde
    eaieyileavklagyepgrdfvlamdaassewkgekkgeyilpkckrkfaseelvahwks
    lcerypivsiedgldeedwegwqymtrelgdkiqlvgddlfvtnterlnkgikercgnsi
    liklnqigtvsetleaikmahkagytavvshrsgetedttiadlavalntgqiktgapsr
    servakynqllrieeelgdsavypgfttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uj2G (G:)
    nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
    gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
    aaalgvplyrflgglnanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqc
    tevfhalagllkskglatsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamd
    aassewkgekkgeyilpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymt
    relgdkiqlvgddlfvtnterlnkgikercgnsiliklnqigtvsetleaikmahkagyt
    avvshrsgetedttiadlavalntgqiktgapsrservakynqllrieeelgdsavypgf
    ttf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3uj2H (H:)
    mhhhhhhssgvdlgtenlyfqsmnyleiekvigreiidsrgnptveaevylaggvtgrgt
    apsgastgefealelrdgdkgrfggkgvtkavqninteiseilsgmdasdiyavdramid
    adgtkdkskfganavlavsiacakaaaaalgvplyrflgglnanrlpvpmmnilnggaha
    antvdvqefmimpvgaesfrealrqctevfhalagllkskglatsvgdeggfapdlasde
    eaieyileavklagyepgrdfvlamdaassewkgekkgeyilpkckrkfaseelvahwks
    lcerypivsiedgldeedwegwqymtrelgdkiqlvgddlfvtnterlnkgikercgnsi
    liklnqigtvsetleaikmahkagytavvshrsgetedttiadlavalntgqiktgapsr
    servakynqllrieeelgdsavypgfttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uj2H (H:)
    nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
    gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
    aaalgvplyrflgglnanrlpvpmmnilnggahaantvdvqefmimpvgaesfrealrqc
    tevfhalagllkskglatsvgdeggfapdlasdeeaieyileavklagyepgrdfvlamd
    aassewkgekkgeyilpkckrkfaseelvahwkslcerypivsiedgldeedwegwqymt
    relgdkiqlvgddlfvtnterlnkgikercgnsiliklnqigtvsetleaikmahkagyt
    avvshrsgetedttiadlavalntgqiktgapsrservakynqllrieeelgdsavypgf
    ttf