PDB entry 3uie

View 3uie on RCSB PDB site
Description: Crystal structure of adenosine 5'-phosphosulfate kinase from Arabidopsis Thaliana in Complex with AMPPNP and APS
Class: transferase/transferase inhibitor
Keywords: Rossmann fold, Kinase, chloroplast, transferase-transferase inhibitor complex
Deposited on 2011-11-04, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylyl-sulfate kinase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AKN1, At2g14750, F26C24.11, T6B13.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uiea_
  • Chain 'B':
    Compound: Adenylyl-sulfate kinase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AKN1, At2g14750, F26C24.11, T6B13.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uieb_
  • Chain 'C':
    Compound: Adenylyl-sulfate kinase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AKN1, At2g14750, F26C24.11, T6B13.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uiec_
  • Heterogens: ADX, ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uieA (A:)
    nstnikwhecsvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyild
    gdnvrhglnrdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllp
    egdfvevfmdvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggts
    piemaekvvgyldnkgylqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uieA (A:)
    csvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdnvrhgln
    rdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegdfvevfm
    dvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggtspiemaekvv
    gyldnkgylqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uieB (B:)
    nstnikwhecsvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyild
    gdnvrhglnrdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllp
    egdfvevfmdvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggts
    piemaekvvgyldnkgylqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uieB (B:)
    nikwhecsvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdn
    vrhglnrdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegd
    fvevfmdvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggtspie
    maekvvgyldnkgylqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uieC (C:)
    nstnikwhecsvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyild
    gdnvrhglnrdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllp
    egdfvevfmdvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggts
    piemaekvvgyldnkgylqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uieC (C:)
    csvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdnvrhgln
    rdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegdfvevfm
    dvplsvceardpkglyklaragkikgftgiddpyepplnceislgtspiemaekvvgyld
    nkgylqa