PDB entry 3uid

View 3uid on RCSB PDB site
Description: Crystal Structure of Protein Ms6760 from Mycobacterium smegmatis
Class: unknown function
Keywords: uncharacterized protein, SRPBCC superfamily, beta sandwich, UNKNOWN FUNCTION, Structural Genomics, TB Structural Genomics Consortium, TBSGC
Deposited on 2011-11-04, released 2011-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.194
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_6760
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0R731 (Start-160)
      • expression tag (161-163)
    Domains in SCOPe 2.06: d3uida1, d3uida2
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_6760
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0R731 (Start-160)
      • expression tag (161-162)
    Domains in SCOPe 2.06: d3uidb1, d3uidb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uidA (A:)
    mpvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpgg
    rvtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpntdlpvstnvytftehdg
    gtratyvgtyasaealqqvldmgviegassainqidalltathhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uidA (A:)
    pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr
    vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpntdlpvstnvytftehdgg
    tratyvgtyasaealqqvldmgviegassainqidalltathh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uidB (B:)
    mpvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpgg
    rvtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpntdlpvstnvytftehdg
    gtratyvgtyasaealqqvldmgviegassainqidalltathhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uidB (B:)
    pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr
    vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpvstnvytftehdggtraty
    vgtyasaealqqvldmgviegassainqidalltath