PDB entry 3ugn

View 3ugn on RCSB PDB site
Description: Crystal Structure of LIGHT
Class: cytokine
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, Jelly-roll, Immunity, TNF Superfamily, HVEM, DcR3, N-glycosylation, Membrane, Secreted protein, CYTOKINE, Atoms-to-Animals: The Immune Function Network, IFN
Deposited on 2011-11-02, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.245
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HVEML, LIGHT, TNFSF14, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-166)
      • see remark 999 (140)
    Domains in SCOPe 2.06: d3ugna_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HVEML, LIGHT, TNFSF14, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-166)
      • see remark 999 (140)
    Domains in SCOPe 2.06: d3ugnb_
  • Chain 'C':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HVEML, LIGHT, TNFSF14, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-166)
      • see remark 999 (140)
    Domains in SCOPe 2.06: d3ugnc_
  • Heterogens: PO4, GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ugnA (A:)
    rshhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgal
    vvtkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratss
    srvwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ugnA (A:)
    npaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggv
    gcplglastithglykrtprypeelellvsqqspcgratrvwwdssflggvvhleageev
    vvrvlderlvrlrdgtrsyfgafmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ugnB (B:)
    rshhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgal
    vvtkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratss
    srvwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ugnB (B:)
    vnpaahltgansssggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggvgc
    plstithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhleageevvv
    rvlderlvrlrdgtrsyfgafmv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ugnC (C:)
    rshhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgal
    vvtkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratss
    srvwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ugnC (C:)
    vnpaahltganssgpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggvgcpl
    glastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhleageevv
    vrvlderlvrlrdgtrsyfgafmv