PDB entry 3ufx

View 3ufx on RCSB PDB site
Description: Thermus aquaticus succinyl-CoA synthetase in complex with GDP-Mn2+
Class: ligase
Keywords: ATP-grasp fold, LIGASE
Deposited on 2011-11-01, released 2012-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-CoA synthetase alpha subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UFX (0-End)
    Domains in SCOPe 2.07: d3ufxa1, d3ufxa2
  • Chain 'B':
    Compound: succinyl-CoA synthetase beta subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UFX (0-End)
  • Chain 'D':
    Compound: succinyl-CoA synthetase alpha subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UFX (0-End)
    Domains in SCOPe 2.07: d3ufxd1, d3ufxd2
  • Chain 'E':
    Compound: succinyl-CoA synthetase beta subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UFX (0-End)
  • Chain 'F':
    Compound: succinyl-CoA synthetase alpha subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UFX (0-End)
    Domains in SCOPe 2.07: d3ufxf1, d3ufxf2
  • Chain 'G':
    Compound: succinyl-CoA synthetase beta subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UFX (0-End)
  • Chain 'H':
    Compound: succinyl-CoA synthetase alpha subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UFX (0-End)
    Domains in SCOPe 2.07: d3ufxh1, d3ufxh2
  • Chain 'I':
    Compound: succinyl-CoA synthetase beta subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UFX (0-End)
  • Heterogens: GDP, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ufxA (A:)
    milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapk
    gkrmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalgwnsrpgil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ufxA (A:)
    milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapk
    gkrmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ufxD (D:)
    milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapk
    gkrmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalgwnsrpgil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ufxD (D:)
    milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapk
    gkrmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ufxF (F:)
    milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapk
    gkrmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalgwnsrpgil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ufxF (F:)
    milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapk
    gkrmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ufxH (H:)
    milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapk
    gkrmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalgwnsrpgil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ufxH (H:)
    milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapk
    gkrmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg
    

  • Chain 'I':
    No sequence available.