PDB entry 3uf2

View 3uf2 on RCSB PDB site
Description: Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine
Class: cytokine
Keywords: hematopoietic cytokine, RTKIII, Four-helix bundle, cytokine
Deposited on 2011-10-31, released 2012-08-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.142
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2a_
  • Chain 'B':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2b_
  • Chain 'C':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2c_
  • Chain 'D':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2d_
  • Chain 'E':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2e_
  • Chain 'F':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2f_
  • Chain 'G':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2g_
  • Chain 'H':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2h_
  • Chain 'I':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2i_
  • Chain 'J':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3uf2j_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uf2A (A:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2A (A:)
    vseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdime
    dtmrfrdntpnaiaivqlqelslrlkscftkdkacvrtfyetplqllekvknvfnetknl
    ldkdwnifskncnnsfaecs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uf2B (B:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2B (B:)
    ycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimedtm
    rfrdntpnaiaivqlqelslrlkscftkdehdkacvrtfyetplqllekvknvfnetknl
    ldkdwnifskncnnsfaec
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uf2C (C:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2C (C:)
    eycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimedt
    mrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfnet
    knlldkdwnifskncnnsfaecs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uf2D (D:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2D (D:)
    ycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimedtm
    rfrdntpnaiaivqlqelslrlkscftkdkacvrtfyetplqllekvknvfnetknlldk
    dwnifskncnnsfaec
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3uf2E (E:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2E (E:)
    vseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdime
    dtmrfrdntpnaiaivqlqelslrlkscftkdydkacvrtfyetplqllekvknvfnetk
    nlldkdwnifskncnnsfaecss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3uf2F (F:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2F (F:)
    seycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimed
    tmrfrdntpnaiaivqlqelslrlkscftkdkacvrtfyetplqllekvknvfnetknll
    dkdwnifskncnnsfaec
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3uf2G (G:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2G (G:)
    seycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimed
    tmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfne
    tknlldkdwnifskncnnsfaecs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3uf2H (H:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2H (H:)
    eycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimedt
    mrfrdntpnaiaivqlqelslrlkscftkdyeacvrtfyetplqllekvknvfnetknll
    dkdwnifskncnnsfaec
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3uf2I (I:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2I (I:)
    vseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdime
    dtmrfrdntpnaiaivqlqelslrlkscftkdkacvrtfyetplqllekvknvfnetknl
    ldkdwnifskncnnsfaecs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3uf2J (J:)
    gshmeevseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafll
    vqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllek
    vknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf2J (J:)
    vseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdime
    dtmrfrdntpnaiaivqlqelslrlkscftkdacvrtfyetplqllekvknvfnetknll
    dkdwnifskncnnsfaecs