PDB entry 3ue9

View 3ue9 on RCSB PDB site
Description: Crystal structure of Adenylosuccinate synthetase (AMPSase) (purA) from Burkholderia thailandensis
Class: ligase
Keywords: SSGCID, LIGASE, AdSS, BTH_I2245, IMP-aspartate ligase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2011-10-28, released 2011-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate synthetase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: purA, BTH_I2245
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ue9a_
  • Chain 'B':
    Compound: adenylosuccinate synthetase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: purA, BTH_I2245
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ue9b_
  • Chain 'C':
    Compound: adenylosuccinate synthetase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: purA, BTH_I2245
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ue9c_
  • Chain 'D':
    Compound: adenylosuccinate synthetase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: purA, BTH_I2245
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ue9d_
  • Heterogens: NA, ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ue9A (A:)
    gpgsmsasavnvtpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnaghtliig
    gkktilrlipsgimregvacyigngvvlspealfkeigeleeaglsvrerlfiseattli
    lpyhiaidqarearkgagkigttgrgigpayedkvgrralrvqdlfdartfadrlrenld
    fhnfvltqylggaavdfqatldtmlgyadrlrpmvadvsrrlyeenhagrnllfegaqgt
    lldidhgtypfvtssncvagaaaagagvgpqklnyilgitkayctrvgsgpfpselydad
    npsrqdqigitlanvgkefgsvtgrprrtgwldaaalrrsiqingvsglcmtkldvldgl
    devklcvgykidgedadllprgaaevarcepvyetfggwkestvginswdalpanarayl
    trvqevagvpidmvstgpdrdetillrhpfkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ue9A (A:)
    tpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnhtgkktilrlipsgimregv
    acyigngvvlspealfkeigeleeaglsvrerlfiseattlilpyhiaidqarearrgig
    payedkvgrralrvqdlfdartfadrlrenldfhnfvltqylggaavdfqatldtmlgya
    drlrpmvadvsrrlyeenhagrnllfegaqgtlldidhgtypfvtssncvagaaaagagv
    gpqklnyilgitkayctrvgsgpfpselydadnpsrqdqigitlanvgkefgsvtgrprr
    tgwldaaalrrsiqingvsglcmtkldvldgldevklcvgykidgedadllprgaaevar
    cepvyetfggwkestvginswdalpanarayltrvqevagvpidmvstgpdrdetillrh
    pfkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ue9B (B:)
    gpgsmsasavnvtpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnaghtliig
    gkktilrlipsgimregvacyigngvvlspealfkeigeleeaglsvrerlfiseattli
    lpyhiaidqarearkgagkigttgrgigpayedkvgrralrvqdlfdartfadrlrenld
    fhnfvltqylggaavdfqatldtmlgyadrlrpmvadvsrrlyeenhagrnllfegaqgt
    lldidhgtypfvtssncvagaaaagagvgpqklnyilgitkayctrvgsgpfpselydad
    npsrqdqigitlanvgkefgsvtgrprrtgwldaaalrrsiqingvsglcmtkldvldgl
    devklcvgykidgedadllprgaaevarcepvyetfggwkestvginswdalpanarayl
    trvqevagvpidmvstgpdrdetillrhpfkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ue9B (B:)
    tpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnaghtilrlipsgimregvac
    yigngvvlspealfkeigeleeaglsvrerlfiseattlilpyhiaidqareargigpay
    edkvgrralrvqdlfdartfadrlrenldfhnfvltqylggaavdfqatldtmlgyadrl
    rpmvadvsrrlyeenhagrnllfegaqgtlldidhgtypfvtssncvagaaaagagvgpq
    klnyilgitkayctrvgsgpfpselydadnpsrqdqigitlanvgkefgsvtgrprrtgw
    ldaaalrrsiqingvsglcmtkldvldgldevklcvgykidgedadllprgaaevarcep
    vyetfggwkestvginswdalpanarayltrvqevagvpidmvstgpdrdetillrhpfk
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ue9C (C:)
    gpgsmsasavnvtpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnaghtliig
    gkktilrlipsgimregvacyigngvvlspealfkeigeleeaglsvrerlfiseattli
    lpyhiaidqarearkgagkigttgrgigpayedkvgrralrvqdlfdartfadrlrenld
    fhnfvltqylggaavdfqatldtmlgyadrlrpmvadvsrrlyeenhagrnllfegaqgt
    lldidhgtypfvtssncvagaaaagagvgpqklnyilgitkayctrvgsgpfpselydad
    npsrqdqigitlanvgkefgsvtgrprrtgwldaaalrrsiqingvsglcmtkldvldgl
    devklcvgykidgedadllprgaaevarcepvyetfggwkestvginswdalpanarayl
    trvqevagvpidmvstgpdrdetillrhpfkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ue9C (C:)
    vtpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnaghtlitilrlipsgimre
    gvacyigngvvlspealfkeigeleeaglsvrerlfiseattlilpyhiaidqareagrg
    igpayedkvgrralrvqdlfdartfadrlrenldfhnfvltqylggaavdfqatldtmlg
    yadrlrpmvadvsrrlyeenhagrnllfegaqgtlldidhgtypfvtssncvagaaaaga
    gvgpqklnyilgitkayctrvgsgpfpselydadnpsrqdqigitlanvgkefgsvtgrp
    rrtgwldaaalrrsiqingvsglcmtkldvldgldevklcvgykidgedadllprgaaev
    arcepvyetfggwkestvginswdalpanarayltrvqevagvpidmvstgpdrdetill
    rhpfkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ue9D (D:)
    gpgsmsasavnvtpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnaghtliig
    gkktilrlipsgimregvacyigngvvlspealfkeigeleeaglsvrerlfiseattli
    lpyhiaidqarearkgagkigttgrgigpayedkvgrralrvqdlfdartfadrlrenld
    fhnfvltqylggaavdfqatldtmlgyadrlrpmvadvsrrlyeenhagrnllfegaqgt
    lldidhgtypfvtssncvagaaaagagvgpqklnyilgitkayctrvgsgpfpselydad
    npsrqdqigitlanvgkefgsvtgrprrtgwldaaalrrsiqingvsglcmtkldvldgl
    devklcvgykidgedadllprgaaevarcepvyetfggwkestvginswdalpanarayl
    trvqevagvpidmvstgpdrdetillrhpfkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ue9D (D:)
    vtpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnaghtltilrlipsgimreg
    vacyigngvvlspealfkeigeleeaglsvrerlfiseattlilpyhiaidqarearrgi
    gpayedkvgrralrvqdlfdartfadrlrenldfhnfvltqylggaavdfqatldtmlgy
    adrlrpmvadvsrrlyeenhagrnllfegaqgtlldidhgtypfvtssncvagaaaagag
    vgpqklnyilgitkayctrvgsgpfpselydadnpsrqdqigitlanvgkefgsvtgrpr
    rtgwldaaalrrsiqingvsglcmtkldvldgldevklcvgykidgedadllprgaaeva
    rcepvyetfggwkestvginswdalpanarayltrvqevagvpidmvstgpdrdetillr
    hpfkv