PDB entry 3udw

View 3udw on RCSB PDB site
Description: Crystal structure of the immunoreceptor TIGIT in complex with Poliovirus receptor (PVR/CD155/necl-5) D1 domain
Class: signaling protein
Keywords: PVR TIGIT IgSF Signal transduction Immunology, IgSF, Cell surface receptor Signalling, glycosylation, Membrane protein, SIGNALING PROTEIN
Deposited on 2011-10-28, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.253
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell immunoreceptor with Ig and ITIM domains
    Species: Homo sapiens [TaxId:9606]
    Gene: TIGIT, VSIG9, VSTM3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: T cell immunoreceptor with Ig and ITIM domains
    Species: Homo sapiens [TaxId:9606]
    Gene: TIGIT, VSIG9, VSTM3
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: poliovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PVR, PVS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3udwc_
  • Chain 'D':
    Compound: poliovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PVR, PVS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3udwd_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3udwC (C:)
    dvvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsys
    eskrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvlakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3udwC (C:)
    dvvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsys
    eskrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3udwD (D:)
    dvvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsys
    eskrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvlakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3udwD (D:)
    dvvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsys
    eskrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvl