PDB entry 3ucy

View 3ucy on RCSB PDB site
Description: Structure of Mg2+ bound N-terminal domain of calmodulin in the presence of Zn2+
Class: calcium-binding protein
Keywords: ef-hand, calcium-binding protein, metal binding, calcium regulation
Deposited on 2011-10-27, released 2012-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM, CALM1, CALM2, CALM3, CALML2, CAM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ucya_
  • Heterogens: NA, MG, ZN, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ucyA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ucyA (A:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkm