PDB entry 3ucw

View 3ucw on RCSB PDB site
Description: Structure of MG2+ bound N-Terminal domain of Calmodulin
Class: calcium-binding protein
Keywords: ef-hand, metal binding, calcium regulation, calcium-binding protein
Deposited on 2011-10-27, released 2012-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.198
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM, CALM1, CALM2, CALM3, CALML2, CAM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ucwa_
  • Chain 'B':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM, CALM1, CALM2, CALM3, CALML2, CAM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ucwb_
  • Chain 'C':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM, CALM1, CALM2, CALM3, CALML2, CAM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ucwc_
  • Chain 'D':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM, CALM1, CALM2, CALM3, CALML2, CAM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ucwd_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ucwA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ucwA (A:)
    lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
    dfpefltmmarkmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ucwB (B:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ucwB (B:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ucwC (C:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ucwC (C:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ucwD (D:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ucwD (D:)
    dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
    tidfpefltmmarkmkdt