PDB entry 3ucu

View 3ucu on RCSB PDB site
Description: The c-di-GMP-I riboswitch bound to pGpG
Class: signaling protein/RNA
Keywords: riboswitch, SIGNALING PROTEIN-RNA complex
Deposited on 2011-10-27, released 2012-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diguanosine monophosphate
  • Chain 'P':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered mutation (30)
      • engineered mutation (35)
    Domains in SCOPe 2.06: d3ucup_
  • Chain 'R':
    Compound: RNA (92-mer)
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download) 
    >3ucuP (P:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records): (download) 
    >3ucuP (P:)
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdi

  • Chain 'R':
    No sequence available.