PDB entry 3ucg
View 3ucg on RCSB PDB site
Description: Crystal structure of a RNA binding domain of polyadenylate-binding protein (PABPN1) from Homo sapiens at 1.95 A resolution
Class: RNA binding protein
Keywords: Ferredoxin-like, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, Partnership for T-Cell Biology, TCELL, RNA BINDING PROTEIN
Deposited on
2011-10-26, released
2011-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated
2014-12-24, with a file datestamp of
2014-12-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.165
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Polyadenylate-binding protein 2
Species: Homo sapiens [TaxId:9606]
Gene: BC010939, PAB2, PABP2, PABPN1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3ucga1, d3ucga2 - Heterogens: SO4, EDO, PEG, PGE, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3ucgA (A:)
gmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkes
vrtslaldeslfrgrqikvipkrtnrpgi
Sequence, based on observed residues (ATOM records): (download)
>3ucgA (A:)
gmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkes
vrtslaldeslfrgrqikvipkrtnrpg