PDB entry 3ucg

View 3ucg on RCSB PDB site
Description: Crystal structure of a RNA binding domain of polyadenylate-binding protein (PABPN1) from Homo sapiens at 1.95 A resolution
Class: RNA binding protein
Keywords: Ferredoxin-like, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, Partnership for T-Cell Biology, TCELL, RNA BINDING PROTEIN
Deposited on 2011-10-26, released 2011-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.165
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyadenylate-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BC010939, PAB2, PABP2, PABPN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86U42 (1-End)
      • leader sequence (0)
    Domains in SCOPe 2.06: d3ucga1, d3ucga2
  • Heterogens: SO4, EDO, PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ucgA (A:)
    gmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkes
    vrtslaldeslfrgrqikvipkrtnrpgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ucgA (A:)
    gmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkes
    vrtslaldeslfrgrqikvipkrtnrpg