PDB entry 3ucb

View 3ucb on RCSB PDB site
Description: Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical Isolate PR20 in Complex with Darunavir
Class: Hydrolase/Hydrolase inhibitor
Keywords: Hydrolase-Hydrolase inhibitor complex
Deposited on 2011-10-26, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.165
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (9)
      • engineered mutation (12)
      • engineered mutation (14)
      • engineered mutation (29)
      • engineered mutation (31-32)
      • engineered mutation (34-36)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (57)
      • engineered mutation (61-62)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (83)
      • engineered mutation (87-89)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3ucba_
  • Chain 'B':
    Compound: Protease
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (9)
      • engineered mutation (12)
      • engineered mutation (14)
      • engineered mutation (29)
      • engineered mutation (31-32)
      • engineered mutation (34-36)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (57)
      • engineered mutation (61-62)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (83)
      • engineered mutation (87-89)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3ucbb_
  • Heterogens: 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ucbA (A:)
    pqitlwkrpfvtvkvggqlkealldtgadntifedinlpgrwkpkmvggiggflkvreyd
    qvpieiaghkvigtvlvgptpvnvigrdtmtqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ucbB (B:)
    pqitlwkrpfvtvkvggqlkealldtgadntifedinlpgrwkpkmvggiggflkvreyd
    qvpieiaghkvigtvlvgptpvnvigrdtmtqigatlnf