PDB entry 3uca

View 3uca on RCSB PDB site
Description: Crystal structure of isoprenoid synthase (target EFI-501974) from clostridium perfringens
Class: transferase
Keywords: isoprenoid synthesis, isoprenoid diphosphate synthase, transferase
Deposited on 2011-10-26, released 2011-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Clostridium perfringens [TaxId:1502]
    Gene: CPE1820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ucaa_
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Clostridium perfringens [TaxId:1502]
    Gene: CPE1820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ucab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ucaA (A:)
    mhhhhhhssgvdlgtenlyfqsmmkkrktledtamninslkeevdqslkayfnkdreynk
    vlydsmaysinvggkrirpilmllsyyiyksdykkiltpamaiemihtyslihddlpcmd
    nddlrrgkptnhkvfgeaiavlagdallneamkilvdysleegksalkatkiiadaagsd
    gmiggqivdiinedkeeislkeldymhlkktgelikasimsgavlaeasegdikklegfg
    yklglafqikddildvvgnakdlgknvhkdqesnknnyitifgleeckkkcvniteecie
    ilssikgnteplkvltmkllerkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ucaA (A:)
    amninslkeevdqslkayfnkdreynkvlydsmaysinvggkrirpilmllsyyiyksdy
    kkiltpamaiemihtyslihddlpcmdnddlrrgkptnhkvfgeaiavlagdallneamk
    ilvdysleegksalkatkiiadaagsdgmiggqivdiinedkeeislkeldymhlkktge
    likasimsgavlaeasegdikklegfgyklglafqikddildvvgnnyitifgleeckkk
    cvniteecieilssikgnteplkvltmkllerkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ucaB (B:)
    mhhhhhhssgvdlgtenlyfqsmmkkrktledtamninslkeevdqslkayfnkdreynk
    vlydsmaysinvggkrirpilmllsyyiyksdykkiltpamaiemihtyslihddlpcmd
    nddlrrgkptnhkvfgeaiavlagdallneamkilvdysleegksalkatkiiadaagsd
    gmiggqivdiinedkeeislkeldymhlkktgelikasimsgavlaeasegdikklegfg
    yklglafqikddildvvgnakdlgknvhkdqesnknnyitifgleeckkkcvniteecie
    ilssikgnteplkvltmkllerkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ucaB (B:)
    amninslkeevdqslkayfnkdreynkvlydsmaysinvggkrirpilmllsyyiyksdy
    kkiltpamaiemihtyslihddlpcmdnddlrrgkptnhkvfgeaiavlagdallneamk
    ilvdysleegksalkatkiiadaagsdgmiggqivdiinedslkeldymhlkktgelika
    simsgavlaeasegdikklegfgyklglafqikddildvvnnyitifgleeckkkcvnit
    eecieilssikgnteplkvltmkllerkf