PDB entry 3uc0

View 3uc0 on RCSB PDB site
Description: Crystal structure of domain I of the envelope glycoprotein ectodomain from dengue virus serotype 4 in complex with the fab fragment of the chimpanzee monoclonal antibody 5H2
Class: viral protein/immune system
Keywords: dengue antibody membrane fusion, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2011-10-25, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Dengue virus 4 [TaxId:11070]
    Gene: ENVELOPE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91AI1 (0-49)
    • Uniprot Q91AI1 (52-107)
      • linker (50-51)
    • Uniprot Q91AI1 (109-End)
      • linker (108)
  • Chain 'B':
    Compound: envelope protein
    Species: Dengue virus 4 [TaxId:11070]
    Gene: ENVELOPE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91AI1 (0-49)
    • Uniprot Q91AI1 (52-107)
      • linker (50-51)
    • Uniprot Q91AI1 (109-End)
      • linker (108)
  • Chain 'H':
    Compound: Heavy chain, monoclonal antibody 5H2
    Species: Pan troglodytes [TaxId:9598]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UC0 (0-End)
  • Chain 'I':
    Compound: Heavy chain, monoclonal antibody 5H2
    Species: Pan troglodytes [TaxId:9598]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UC0 (0-End)
  • Chain 'L':
    Compound: Light chain, monoclonal antibody 5H2
    Species: Pan troglodytes [TaxId:9598]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UC0
    Domains in SCOPe 2.07: d3uc0l1, d3uc0l2
  • Chain 'M':
    Compound: Light chain, monoclonal antibody 5H2
    Species: Pan troglodytes [TaxId:9598]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UC0
    Domains in SCOPe 2.07: d3uc0m1, d3uc0m2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3uc0L (L:)
    aelqmtqspsslsasvgdrvtitcrasqdisirlnwyqqkpgkapklliydastlesgvp
    srfsgsgsgtdftltisslqpedfatyycqqfnsypltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvacllnnfypreakvqwkvdnalqsgnsqesvteqdskdntyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uc0L (L:)
    elqmtqspsslsasvgdrvtitcrasqdisirlnwyqqkpgkapklliydastlesgvps
    rfsgsgsgtdftltisslqpedfatyycqqfnsypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvacllnnfypreakvqwkvdnalqsgnsqesvteqdskdntyslsstlt
    lskadyekhkvyacevthqglsspvtksf
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3uc0M (M:)
    aelqmtqspsslsasvgdrvtitcrasqdisirlnwyqqkpgkapklliydastlesgvp
    srfsgsgsgtdftltisslqpedfatyycqqfnsypltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvacllnnfypreakvqwkvdnalqsgnsqesvteqdskdntyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uc0M (M:)
    elqmtqspsslsasvgdrvtitcrasqdisirlnwyqqkpgkapklliydastlesgvps
    rfsgsgsgtdftltisslqpedfatyycqqfnsypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvacllnnfypreakvqwkvdnalqsgnsqesvteqdskdntyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr