PDB entry 3ual

View 3ual on RCSB PDB site
Description: Crystal Structure of 14-3-3 epsilon with Mlf1 peptide
Class: signaling protein/protein binding
Keywords: Adapter protein, ALL HELICAL, PHOSPHOPETIDE, SIGNALING PROTEIN-PROTEIN BINDING complex
Deposited on 2011-10-21, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uala_
  • Chain 'P':
    Compound: Myeloid leukemia factor 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ualA (A:)
    mddredlvyqaklaeqaerydemvesmkkvagmdveltveernllsvayknvigarrasw
    riissieqkeenkggedklkmireyrqmvetelkliccdildvldkhlipaantgeskvf
    yykmkgdyhrylaefatgndrkeaaenslvaykaasdiamtelppthpirlglalnfsvf
    yyeilnspdracrlakaafddaiaeldtlseesykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ualA (A:)
    dredlvyqaklaeqaerydemvesmkkvagmdveltveernllsvayknvigarraswri
    issieqkeenkggedklkmireyrqmvetelkliccdildvldkhlipaantgeskvfyy
    kmkgdyhrylaefatgndrkeaaenslvaykaasdiamtelppthpirlglalnfsvfyy
    eilnspdracrlakaafddaiaeldtlseesykdstlimqllrdnltlwt
    

  • Chain 'P':
    No sequence available.