PDB entry 3ua1

View 3ua1 on RCSB PDB site
Description: Crystal structure of the cytochrome P4503A4-bromoergocryptine complex
Class: oxidoreductase
Keywords: Protein-substrate complex, monooxygenase, cytochrome P450 reductase, cytochrome b5, membrane, OXIDOREDUCTASE
Deposited on 2011-10-20, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ua1a_
  • Heterogens: HEM, 08Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ua1A (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ua1A (A:)
    hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
    dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
    iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
    kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkeedtqvdflq
    lmidsqhkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlp
    nkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsya
    lhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvl
    qnfsfkpcketqiplklslggllqpekpvvlkvesr