PDB entry 3u9x

View 3u9x on RCSB PDB site
Description: Covalent attachment of pyridoxal-phosphate derivatives to 14-3-3 proteins
Class: signaling protein/inhibitor
Keywords: 14-3-3, ADAPTER PROTEIN, PROTEIN-PROTEIN INTERACTION, N6-pyridoxal phosphate-L-lysine (PSI-MOD:128), SIGNALING PROTEIN-INHIBITOR complex
Deposited on 2011-10-20, released 2012-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.136
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: HME1, NM_006142, SFN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (4-234)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3u9xa1, d3u9xa2
  • Heterogens: MG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u9xA (A:)
    amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
    aawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaes
    rvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnf
    svfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9xA (A:)
    amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
    aawrvlssieqksngpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkm
    kgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyei
    anspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt