PDB entry 3u9i

View 3u9i on RCSB PDB site
Description: The crystal structure of Mandelate racemase/muconate lactonizing enzyme from Roseiflexus sp.
Class: isomerase
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, ISOMERASE
Deposited on 2011-10-19, released 2011-11-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme, C-terminal domain protein
    Species: Roseiflexus sp. RS-1 [TaxId:357808]
    Gene: RoseRS_2982
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3u9ia1, d3u9ia2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme, C-terminal domain protein
    Species: Roseiflexus sp. RS-1 [TaxId:357808]
    Gene: RoseRS_2982
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3u9ib1, d3u9ib2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u9iA (A:)
    mhhhhhhssgvdlgtenlyfqsmtapttiraltvapldiplhepfgiasgaqevarnllv
    aveltdgtrgygeaapfpafngetqdmahaailaarslvegadvrewrrialalpalpgm
    tgsarcaietaildaltrrarlplwaffggaatsletdvtittgsvtaaaraaqaivarg
    vttikikigagdpdattirtmehdlarivairdvaptarlildgncgytapdalrlldml
    gvhgivpalfeqpvakddeeglrrltatrrvpvaadesvasatdaarlarnaavdvlnik
    lmkcgivealdiaaiartaglhlmiggmvesllamtvsacfaagqggfrfvdldtplfla
    enpfdggmtyhggtidltlieaghgvtprspal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9iA (A:)
    tapttiraltvapldiplhevarnllvaveltdgtrgygeaapfpafngetqdmahaail
    aarslvegadvrewrrialalpalpgmtgsarcaietaildaltrrarlplwaffggaat
    sletdvtitvtaaaraaqaivargvttikikigtirtmehdlarivairdvaptarlild
    gncgytapdalrlldmlgvhgivpalfeqpvakddeeglrrltatrrvpvaadesvasat
    daarlarnaavdvlniklmkcgivealdiaaiartaglhlmiggmvesllamtvsacfaa
    gqggfrfvdldtplflaenpfdggmtyhggtidltlieaghgvtpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u9iB (B:)
    mhhhhhhssgvdlgtenlyfqsmtapttiraltvapldiplhepfgiasgaqevarnllv
    aveltdgtrgygeaapfpafngetqdmahaailaarslvegadvrewrrialalpalpgm
    tgsarcaietaildaltrrarlplwaffggaatsletdvtittgsvtaaaraaqaivarg
    vttikikigagdpdattirtmehdlarivairdvaptarlildgncgytapdalrlldml
    gvhgivpalfeqpvakddeeglrrltatrrvpvaadesvasatdaarlarnaavdvlnik
    lmkcgivealdiaaiartaglhlmiggmvesllamtvsacfaagqggfrfvdldtplfla
    enpfdggmtyhggtidltlieaghgvtprspal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9iB (B:)
    mtapttiraltvapldiplhvarnllvaveltdgtrgygeaapfpafngetqdmahaail
    aarslvegadvrewrrialalpalpgmtgsarcaietaildaltrrarlplwaffggaat
    sletdvtittgsvtaaaraaqaivargvttikikigagttirtmehdlarivairdvapt
    arlildgncgytapdalrlldmlgvhgivpalfeqpvakddeeglrrltatrrvpvaade
    svasatdaarlarnaavdvlniklmkcgivealdiaaiartaglhlmiggmvesllamtv
    sacfaagqggfrfvdldtplflaenpfdggmtyhggtidltlieaghgvtprsp