PDB entry 3u8z

View 3u8z on RCSB PDB site
Description: human merlin FERM domain
Class: signaling protein
Keywords: neurofibromatosis, tumor suppressor, SIGNALING PROTEIN
Deposited on 2011-10-17, released 2011-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u8za1, d3u8za2
  • Chain 'B':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u8zb1, d3u8zb2
  • Chain 'C':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u8zc1, d3u8zc2, d3u8zc3
  • Chain 'D':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u8zd1, d3u8zd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u8zA (A:)
    gplgsqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtv
    awlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiy
    cppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawy
    aehrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltp
    kisfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8zA (A:)
    ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
    kvlpvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycppeasvllasyavq
    akygdqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyfairnkkgtel
    llgvdalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrv
    nklilqlcignhdlfmrrrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u8zB (B:)
    gplgsqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtv
    awlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiy
    cppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawy
    aehrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltp
    kisfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8zB (B:)
    ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
    kvlpvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycppeasvllasyavq
    akygdqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyfairnkkgtel
    llgvdalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrv
    nklilqlcignhdlfmrrrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3u8zC (C:)
    gplgsqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtv
    awlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiy
    cppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawy
    aehrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltp
    kisfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8zC (C:)
    ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
    kvlpvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycppeasvllasyavq
    akygdydpsvhqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyfairn
    kkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfn
    ssklrvnklilqlcignhdlfmrrrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3u8zD (D:)
    gplgsqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtv
    awlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiy
    cppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawy
    aehrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltp
    kisfpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8zD (D:)
    ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
    kvlpvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycppeasvllasyavq
    akyardeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltpkis
    fpwneirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk