PDB entry 3u7a

View 3u7a on RCSB PDB site
Description: al-09 y32f y96f
Class: immune system
Keywords: immunoglobulin light chain variable domain, IMMUNE SYSTEM
Deposited on 2011-10-13, released 2012-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-09 Y32F Y96F, variable domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7A
    Domains in SCOPe 2.07: d3u7aa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u7aA (A:)
    stdiqmtqspsslsasvgdrvtitcqasqdinnfliwyqqkpgqapklliydastletgv
    psrfsgsgsgteftftisslqpedlatyhcqqydnlpftfgqgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u7aA (A:)
    diqmtqspsslsasvgdrvtitcqasqdinnfliwyqqkpgqapklliydastletgvps
    rfsgsgsgteftftisslqpedlatyhcqqydnlpftfgqgtkleik