PDB entry 3u6k

View 3u6k on RCSB PDB site
Description: Ef-tu (escherichia coli) in complex with nvp-ldk733
Class: translation factor/antibiotic
Keywords: translation factor-antibiotic complex
Deposited on 2011-10-12, released 2012-02-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor Tu 1
    Species: Escherichia coli [TaxId:83333]
    Gene: tufA, b3339, JW3301
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3u6ka1, d3u6ka2, d3u6ka3
  • Chain 'B':
    Compound: Elongation factor Tu 1
    Species: Escherichia coli [TaxId:83333]
    Gene: tufA, b3339, JW3301
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3u6kb1, d3u6kb2, d3u6kb3
  • Chain 'C':
    Compound: Thiocillin GE2270 analogue NVP-LDK733
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M0J8 (0-11)
      • see remark 999 (11)
  • Chain 'D':
    Compound: Thiocillin GE2270 analogue NVP-LDK733
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M0J8 (0-11)
      • see remark 999 (11)
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u6kA (A:)
    makekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekarg
    itintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehi
    llgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkale
    gdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvg
    eeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtik
    phtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmv
    vtlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6kA (A:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u6kB (B:)
    makekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekarg
    itintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehi
    llgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkale
    gdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvg
    eeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtik
    phtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmv
    vtlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6kB (B:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvlg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.