PDB entry 3u5y

View 3u5y on RCSB PDB site
Description: Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity
Class: hydrolase
Keywords: glucosidase, HYDROLASE
Deposited on 2011-10-11, released 2011-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: Rauvolfia serpentina [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SPP9 (Start-512)
      • engineered mutation (185)
    Domains in SCOPe 2.06: d3u5ya_
  • Chain 'B':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: Rauvolfia serpentina [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SPP9 (Start-512)
      • engineered mutation (185)
    Domains in SCOPe 2.06: d3u5yb_
  • Heterogens: SCG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u5yA (A:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnqpwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u5yA (A:)
    datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
    dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
    kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnqpwtfsv
    hgyatglyapgrgrstgnpgtepywvthhlllahaaavelyknkfqrgqegqigishatq
    wmepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskmlk
    gsydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirki
    lvytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnv
    kgyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u5yB (B:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnqpwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u5yB (B:)
    datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
    dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
    kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnqpwtfsv
    hgyatglyapgrgrstgnpgtepywvthhlllahaaavelyknkfqrgqegqigishatq
    wmepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskmlk
    gsydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirki
    lvytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnv
    kgyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk