PDB entry 3u5g

View 3u5g on RCSB PDB site
Description: The structure of the eukaryotic ribosome at 3.0 A resolution. This entry contains proteins of the 40S subunit, ribosome B
Class: ribosome
Keywords: Translation, ribosome, 40S, 60S, 80S, ribosomal, ribosomal RNA, rRNA, ribosomal protein, STM1, eukaryotic ribosome, RNA-protein complex
Deposited on 2011-10-11, released 2011-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.182
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 40S ribosomal protein S0-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32905
• Chain 'B':
  Compound: 40S ribosomal protein S1-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P33442
• Chain 'C':
  Compound: 40S ribosomal protein S2
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25443
• Chain 'D':
  Compound: 40S ribosomal protein S3
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05750
• Chain 'E':
  Compound: 40S ribosomal protein S4-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX35 (Start-260)
• Chain 'F':
  Compound: 40S ribosomal protein S5
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26783 (Start-224)
• Chain 'G':
  Compound: 40S ribosomal protein S6-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX37 (0-End)
• Chain 'H':
  Compound: 40S ribosomal protein S7-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26786
• Chain 'I':
  Compound: 40S ribosomal protein S8-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX39 (Start-199)
• Chain 'J':
  Compound: 40S ribosomal protein S9-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O13516
• Chain 'K':
  Compound: 40S ribosomal protein S10-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08745 (0-End)
• Chain 'L':
  Compound: 40S ribosomal protein S11-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX47
• Chain 'M':
  Compound: 40s ribosomal protein s12
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48589 (Start-142)
• Chain 'N':
  Compound: 40S ribosomal protein S13
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05756 (Start-150)
• Chain 'O':
  Compound: 40S ribosomal protein S14-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06367 (Start-136)
• Chain 'P':
  Compound: 40S ribosomal protein S15
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01855
• Chain 'Q':
  Compound: 40S ribosomal protein S16-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX51 (Start-142)
• Chain 'R':
  Compound: 40S ribosomal protein S17-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02407
• Chain 'S':
  Compound: 40S ribosomal protein S18-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX55 (Start-145)
• Chain 'T':
  Compound: 40S ribosomal protein S19-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07280 (Start-143)
• Chain 'U':
  Compound: 40S ribosomal protein S20
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38701 (Start-120)
• Chain 'V':
  Compound: 40S ribosomal protein S21-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C0V8 (0-86)
• Chain 'W':
  Compound: 40S ribosomal protein S22-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C0W1 (Start-129)
• Chain 'X':
  Compound: 40S ribosomal protein S23-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX29 (Start-144)
• Chain 'Y':
  Compound: 40S ribosomal protein S24-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX31 (Start-134)
• Chain 'Z':
  Compound: 40S ribosomal protein S25-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3E792
• Chain 'a':
  Compound: 40S ribosomal protein S26-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39938
  Domains in SCOPe 2.08: d3u5ga_
• Chain 'b':
  Compound: 40S ribosomal protein S27-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35997 (Start-81)
  Domains in SCOPe 2.08: d3u5gb_
• Chain 'c':
  Compound: 40S ribosomal protein S28-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3E7X9 (Start-66)
  Domains in SCOPe 2.08: d3u5gc_
• Chain 'd':
  Compound: 40S ribosomal protein S29-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41057 (Start-55)
  Domains in SCOPe 2.08: d3u5gd_
• Chain 'e':
  Compound: 40S ribosomal protein S30-A
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX33 (Start-62)
  Domains in SCOPe 2.08: d3u5ge_
• Chain 'f':
  Compound: 40S ribosomal protein S31
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05759 (Start-151)
    • see remark 999 (76-100)
  Domains in SCOPe 2.08: d3u5gf_
• Chain 'g':
  Compound: Guanine nucleotide-binding protein subunit beta-like protein (ASC1, RACK1)
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38011 (Start-318)
  Domains in SCOPe 2.08: d3u5gg_
• Chain 'h':
  Compound: Suppressor protein STM1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39015
    • see remark 999 (118-138)
    • see remark 999 (154-173)
  Domains in SCOPe 2.08: d3u5gh_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'V':
  No sequence available.
  
  
• Chain 'W':
  No sequence available.
  
  
• Chain 'X':
  No sequence available.
  
  
• Chain 'Y':
  No sequence available.
  
  
• Chain 'Z':
  No sequence available.
  
  
• Chain 'a':
  Sequence, based on SEQRES records: (download)
  

  >3u5ga (a:)
  mpkkrasngrnkkgrghvkpvrcvncsksipkdkaikrmairniveaaavrdlseasvyp
  eyalpktynklhycvscaiharivrvrsredrknrappqrprfnrenkvspadaakkal
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3u5ga (a:)
  pkkrasngrnkkgrghvkpvrcvncsksipkdkaikrmairniveaaavrdlseasvype
  yalpktynklhycvscaiharivrvrsredrknrapp
  

  
  
• Chain 'b':
  Sequence, based on SEQRES records: (download)
  

  >3u5gb (b:)
  mvlvqdllhptaasearkhklktlvqgprsyfldvkcpgclnittvfshaqtavtcescs
  tilctptggkaklsegtsfrrk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3u5gb (b:)
  vlvqdllhptaasearkhklktlvqgprsyfldvkcpgclnittvfshaqtavtcescst
  ilctptggkaklsegtsfrrk
  

  
  
• Chain 'c':
  Sequence, based on SEQRES records: (download)
  

  >3u5gc (c:)
  mdnktpvtlakvikvlgrtgsrggvtqvrvefledtsrtivrnvkgpvrendilvlmese
  rearrlr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3u5gc (c:)
  tpvtlakvikvlgrtgsrggvtqvrvefledtsrtivrnvkgpvrendilvlmeserear
  rlr
  

  
  
• Chain 'd':
  Sequence, based on SEQRES records: (download)
  

  >3u5gd (d:)
  mahenvwfshprrygkgsrqcrvcsshtglirkyglnicrqcfrekandigfnkfr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3u5gd (d:)
  envwfshprrygkgsrqcrvcsshtglirkyglnicrqcfrekandigfnkfr
  

  
  
• Chain 'e':
  Sequence, based on SEQRES records: (download)
  

  >3u5ge (e:)
  makvhgslaragkvksqtpkvektekpkkpkgraykrllytrrfvnvtlvngkrrmnpgp
  svq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3u5ge (e:)
  akvhgslaragkvksqtpkvektekpkkpkgraykrllytrrfvnvtlvngkrrmnpgps
  vq
  

  
  
• Chain 'f':
  Sequence, based on SEQRES records: (download)
  

  >3u5gf (f:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlrggxxxxxxxxxxxxxxxxxxxxxxxxxvlsyykvdaegkvtklrre
  csnptcgagvflanhkdrlycgkchsvykvna
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3u5gf (f:)
  xxxxxxxxxxxxxxxxxxxxxxxxxvlsyykvdaegkvtklrrecsnptcgagvflanhk
  drlycgkchsvykvna
  

  
  
• Chain 'g':
  Sequence, based on SEQRES records: (download)
  

  >3u5gg (g:)
  masnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrs
  fkghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkas
  miisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvka
  wnlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdev
  fslafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqt
  lfagytdnvirvwqvmtan
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3u5gg (g:)
  asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
  kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
  iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
  nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
  slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
  fagytdnvirvwqvmtan
  

  
  
• Chain 'h':
  Sequence, based on SEQRES records: (download)
  

  >3u5gh (h:)
  msnpfdllgndvedadvvvlppkeivksntsskkadvpppsadpskarknrprpsgnega
  irdktagrrnnrskdvtdsattkksntrratdrhsrtgktdtkkkvnqgwgddkkelsxx
  xxxxxxxxxxxxxxxxxxxdagkpktaqlslqdyxxxxxxxxxxxxxxxxxxxxdaerie
  taekeayvpatkvknvkskqlktkeylefdatfvesntrknfgdrnnnsrnnfnnrrggr
  garkgnntanatnsantvqknrnidvsnlpsla
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3u5gh (h:)
  keivksntsskkadvpppsadpskarknrprpsgnegairdktagrrnnrskdvtdsatt
  kksxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx