PDB entry 3u57

View 3u57 on RCSB PDB site
Description: Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity
Class: hydrolase
Keywords: Alkaloid Glucosidases, HYDROLASE
Deposited on 2011-10-11, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.208
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: Rauvolfia serpentina [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SPP9 (Start-512)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d3u57a_
  • Chain 'B':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: Rauvolfia serpentina [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SPP9 (Start-512)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d3u57b_
  • Heterogens: DH8, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u57A (A:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnqpwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u57A (A:)
    ndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdva
    vdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllang
    ikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnqpwtfs
    vhgyatglyapgrgrstgnpgtepywvthhlllahaaavelyknkfqrgqegqigishat
    qwmepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskml
    kgsydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirk
    ilvytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvn
    vkgyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u57B (B:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnqpwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u57B (B:)
    ndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdva
    vdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllang
    ikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnqpwtfs
    vhgyatglyapgrgrstgnpgtepywvthhlllahaaavelyknkfqrgqegqigishat
    qwmepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskml
    kgsydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirk
    ilvytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvn
    vkgyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk