PDB entry 3u51

View 3u51 on RCSB PDB site
Description: Src in complex with DNA-templated macrocyclic inhibitor MC1
Class: transferase/transferase inhibitor
Keywords: protein kinase, Src-like inactive conformation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-10-10, released 2012-02-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3u51a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3u51b_
  • Heterogens: 08X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u51A (A:)
    aweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklr
    heklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayve
    rmnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygr
    ftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqc
    wrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u51A (A:)
    eipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhe
    klvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayverm
    nyvhrdlraanilvgenlvckvadfgfpikwtapeaalygrftiksdvwsfgillteltt
    kgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafle
    dyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u51B (B:)
    aweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklr
    heklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayve
    rmnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygr
    ftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqc
    wrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u51B (B:)
    eipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhe
    klvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayverm
    nyvhrdlraanilvgenlvckvadfgpikwtapeaalygrftiksdvwsfgilltelttk
    grvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafled
    yftstepqyqpgenl