PDB entry 3u4x

View 3u4x on RCSB PDB site
Description: Crystal structure of a lectin from Camptosema pedicellatum seeds in complex with 5-bromo-4-chloro-3-indolyl-alpha-D-mannose
Class: carbohydrate-binding protein
Keywords: jelly-roll domain, lectin, carbohydrate-binding protein
Deposited on 2011-10-10, released 2012-09-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-09-12, with a file datestamp of 2012-09-07.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.193
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camptosema pedicellatum lectin (CPL)
    Species: Camptosema pedicellatum [TaxId:232302]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U4X (0-235)
    Domains in SCOPe 2.03: d3u4xa_
  • Heterogens: CA, MN, XMM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u4xA (A:)
    adtivaveldtypntdigdpnyqhiginiksirskattrwnvqdgkvgtahisynsvakr
    lsaivsypggssatvsydvdlnnilpewvrvglsastgvyketntilswsftsklktnst
    adaqslhftfnqfsqspkdlilqgdastdsdgnlqltrvsngspqsnsvgralyyapvhv
    wdksavvasfdatftflikspdsdpadgiaffiantdssiphgsggrllglfpdan