PDB entry 3u4j

View 3u4j on RCSB PDB site
Description: Crystal structure of NAD-dependent aldehyde dehydrogenase from Sinorhizobium meliloti
Class: oxidoreductase
Keywords: PSI-Biology, NYSGRC, Structural Genomics, New York Structural Genomics Research Consortium, tetramer, NAD, OXIDOREDUCTASE
Deposited on 2011-10-08, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0117, SMa0220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q930S8 (2-505)
      • expression tag (1)
    Domains in SCOPe 2.07: d3u4ja1, d3u4ja2
  • Chain 'B':
    Compound: NAD-dependent aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0117, SMa0220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u4jb_
  • Chain 'C':
    Compound: NAD-dependent aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0117, SMa0220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q930S8 (2-505)
      • expression tag (1)
    Domains in SCOPe 2.07: d3u4jc1, d3u4jc2
  • Chain 'D':
    Compound: NAD-dependent aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0117, SMa0220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u4jd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u4jA (A:)
    mvmlsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasa
    ddvrkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqa
    rgeigfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiase
    rvpwaigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpn
    vdmvaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhna
    gqccisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvt
    agitsgaelllggerigreaglyyaptvfagvtpdmsiareeifgpvlstltfktadeav
    alanatefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrel
    grygfdeysqfkgvhvtlgrpapwftaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u4jA (A:)
    vmlsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasad
    dvrkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqar
    geigfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiaser
    vpwaigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpnv
    dmvaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhnag
    qccisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvta
    gitsgaelllggerigreaglyyaptvfagvtpdmsiareeifgpvlstltfktadeava
    lanatefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrelg
    rygfdeysqfkgvhvtlgrpapwft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u4jB (B:)
    mvmlsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasa
    ddvrkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqa
    rgeigfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiase
    rvpwaigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpn
    vdmvaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhna
    gqccisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvt
    agitsgaelllggerigreaglyyaptvfagvtpdmsiareeifgpvlstltfktadeav
    alanatefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrel
    grygfdeysqfkgvhvtlgrpapwftaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u4jB (B:)
    lsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasaddv
    rkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqarge
    igfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiaservp
    waigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpnvdm
    vaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhnagqc
    cisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvtagi
    tsgaelllggerigeaglyyaptvfagvtpdmsiareeifgpvlstltfktadeavalan
    atefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrelgryg
    fdeysqfkgvhvtlgrpapwft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3u4jC (C:)
    mvmlsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasa
    ddvrkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqa
    rgeigfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiase
    rvpwaigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpn
    vdmvaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhna
    gqccisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvt
    agitsgaelllggerigreaglyyaptvfagvtpdmsiareeifgpvlstltfktadeav
    alanatefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrel
    grygfdeysqfkgvhvtlgrpapwftaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u4jC (C:)
    vmlsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasad
    dvrkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqar
    geigfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiaser
    vpwaigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpnv
    dmvaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhnag
    qccisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvta
    gitsgaelllggerigreaglyyaptvfagvtpdmsiareeifgpvlstltfktadeava
    lanatefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrelg
    rygfdeysqfkgvhvtlgrpapwft
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3u4jD (D:)
    mvmlsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasa
    ddvrkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqa
    rgeigfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiase
    rvpwaigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpn
    vdmvaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhna
    gqccisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvt
    agitsgaelllggerigreaglyyaptvfagvtpdmsiareeifgpvlstltfktadeav
    alanatefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrel
    grygfdeysqfkgvhvtlgrpapwftaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u4jD (D:)
    lsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasaddv
    rkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqarge
    igfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiaservp
    waigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpnvdm
    vaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhnagqc
    cisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvtagi
    tsgaelllggerigreaglyyaptvfagvtpdmsiareeifgpvlstltfktadeavala
    natefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrelgry
    gfdeysqfkgvhvtlgrpapwft