PDB entry 3u2q

View 3u2q on RCSB PDB site
Description: EF-Tu (Escherichia coli) in complex with NVP-LFF571
Class: translation factor/antibiotic
Keywords: translation factor-antibiotic complex
Deposited on 2011-10-04, released 2012-05-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor Tu 1
    Species: Escherichia coli [TaxId:83333]
    Gene: tufA, b3339, JW3301
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3u2qa1, d3u2qa2, d3u2qa3
  • Chain 'B':
    Compound: nvp-lff571
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M0J8 (0-11)
      • see remark 999 (11)
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u2qA (A:)
    makekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekarg
    itintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehi
    llgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkale
    gdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvg
    eeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtik
    phtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmv
    vtlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u2qA (A:)
    ertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekatintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvlg
    

  • Chain 'B':
    No sequence available.