PDB entry 3u2k

View 3u2k on RCSB PDB site
Description: S. aureus GyrB ATPase domain in complex with a small molecule inhibitor
Class: isomerase/isomerase inhibitor
Keywords: protein-inhibitor complex, ATP-binding, structure-based drug design, antimicrobial, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2011-10-03, released 2012-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.158
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u2ka_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u2kb_
  • Heterogens: 087, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u2kA (A:)
    mygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievvie
    kdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykk
    gvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrd
    erdeenvredsyhyeggi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u2kA (A:)
    ygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviek
    dnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkg
    vpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrde
    rdeenvredsyhye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u2kB (B:)
    mygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievvie
    kdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykk
    gvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrd
    erdeenvredsyhyeggi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u2kB (B:)
    qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
    tdngrgipvdiqgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkev
    gttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvred
    syhye