PDB entry 3u1m

View 3u1m on RCSB PDB site
Description: Structure of the mRNA splicing complex component Cwc2
Class: splicing
Keywords: CSMP, Zinc Finger, mRNA splicing, SPLICING
Deposited on 2011-09-30, released 2011-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.161
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor CWC2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CWC2, NTC40, SLC3, YDL209C, D1041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u1ma1, d3u1ma2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u1mA (A:)
    mtswrdksakvqvkeselpssipaqtgltfniwynkwsqgfagntrfvspfalqpqlhsg
    ktrgdndgqlffclffakgmcclgpkceylhhipdeedigklalrtevldcfgrekfady
    redmggigsfrkknktlyvggidgalnskhlkpaqiesrirfvfsrlgdidriryveskn
    cgfvkfkyqanaefakeamsnqtlllpsdkewddrregtgllvkwanedpdpaaqkrlqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u1mA (A:)
    tswrdksakvqvkeselpssipaqtgltfniwynkwsqgfagntrfvspfalqpqlhsgk
    trgdndgqlffclffakgmcclgpkceylhhipdeedigklalrtevldcfgrekfadyr
    edmggkknktlyvggidgalnskhlkpaqiesrirfvfsrlgdidriryveskncgfvkf
    kyqanaefakeamsnqtlllpsdkewddrregtgllvkwan