PDB entry 3u10

View 3u10 on RCSB PDB site
Description: Tetramerization dynamics of the C-terminus underlies isoform-specific cAMP-gating in HCN channels
Class: transport protein
Keywords: transport protein
Deposited on 2011-09-29, released 2011-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN2, BCNG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u10a_
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u10A (A:)
    qgpsspmdssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgel
    ngplreeivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmy
    fiqhgvvsvltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevl
    eeypmmrrafetvaidrldrigkknsillh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u10A (A:)
    dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
    ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
    svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
    rafetvaidrldrigkknsill