PDB entry 3u0v

View 3u0v on RCSB PDB site
Description: Crystal Structure Analysis of human LYPLAL1
Class: hydrolase
Keywords: alpha, beta hydrolase fold, HYDROLASE
Deposited on 2011-09-29, released 2011-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysophospholipase-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLAL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VWZ2
      • see remark 999 (132)
    Domains in SCOPe 2.06: d3u0va_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u0vA (A:)
    gpmaaasgsvlqrcivspagrhsasliflhgsgdsgqglrmwikqvlnqdltfqhikiiy
    ptapprsytpmkggisnvwfdrfkitndcpehlesidvmcqvltdlideevksgikknri
    liggfsmggcmamhlayrnhqdvagvfalssflnkasavyqalqksngvlpelfqchgta
    delvlhswaeetnsmlkslgvttkfhsfpnvyhelskteldilklwiltklpgemekqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0vA (A:)
    lqrcivspagrhsasliflhgsgdsgqglrmwikqvlnqdltfqhikiiyptapprsytp
    mkggisnvwfdrfkitndcpehlesidvmcqvltdlideevksgikknriliggfsmggc
    mamhlayrnhqdvagvfalssflnkasavyqalqksngvlpelfqchgtadelvlhswae
    etnsmlkslgvttkfhsfpnvyhelskteldilklwiltklp