PDB entry 3u0g

View 3u0g on RCSB PDB site
Description: Crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei
Class: transferase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, PyridoxaL 5'-Phosphate Dependent Enzymes class IV, branched chain amino transferase, PyridoxaL 5'-Phosphate, TRANSFERASE
Deposited on 2011-09-28, released 2011-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative branched-chain amino acid aminotransferase IlvE
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: ilvE, BPSL0793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u0ga_
  • Chain 'B':
    Compound: Putative branched-chain amino acid aminotransferase IlvE
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: ilvE, BPSL0793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u0gb_
  • Chain 'C':
    Compound: Putative branched-chain amino acid aminotransferase IlvE
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: ilvE, BPSL0793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u0gc_
  • Chain 'D':
    Compound: Putative branched-chain amino acid aminotransferase IlvE
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: ilvE, BPSL0793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u0gd_
  • Chain 'E':
    Compound: Putative branched-chain amino acid aminotransferase IlvE
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: ilvE, BPSL0793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u0ge_
  • Chain 'F':
    Compound: Putative branched-chain amino acid aminotransferase IlvE
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: ilvE, BPSL0793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u0gf_
  • Heterogens: PO4, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u0gA (A:)
    mahhhhhhmgtleaqtqgpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfe
    gvrayktadggtaifrlkehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescyl
    rpiiwigseklgvsakgntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvr
    akasgwyvnsilanqeatadgydeallldvdgyvsegsgenfflvnrgklytpdlascld
    gitrdtvitlakeagieviekritrdevytadeafftgtaaevtpireldnrtigggarg
    piteklqsaffdvvngksakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0gA (A:)
    msmadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkeht
    krllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntih
    vaiaawpwgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgydea
    llldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekritr
    devytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakhadwl
    tki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u0gB (B:)
    mahhhhhhmgtleaqtqgpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfe
    gvrayktadggtaifrlkehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescyl
    rpiiwigseklgvsakgntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvr
    akasgwyvnsilanqeatadgydeallldvdgyvsegsgenfflvnrgklytpdlascld
    gitrdtvitlakeagieviekritrdevytadeafftgtaaevtpireldnrtigggarg
    piteklqsaffdvvngksakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0gB (B:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgydeallldvdgy
    vsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekritrdevytade
    afftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakhadwltki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3u0gC (C:)
    mahhhhhhmgtleaqtqgpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfe
    gvrayktadggtaifrlkehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescyl
    rpiiwigseklgvsakgntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvr
    akasgwyvnsilanqeatadgydeallldvdgyvsegsgenfflvnrgklytpdlascld
    gitrdtvitlakeagieviekritrdevytadeafftgtaaevtpireldnrtigggarg
    piteklqsaffdvvngksakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0gC (C:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgydeallld
    vdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekritrdevy
    tadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakhadwltki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3u0gD (D:)
    mahhhhhhmgtleaqtqgpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfe
    gvrayktadggtaifrlkehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescyl
    rpiiwigseklgvsakgntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvr
    akasgwyvnsilanqeatadgydeallldvdgyvsegsgenfflvnrgklytpdlascld
    gitrdtvitlakeagieviekritrdevytadeafftgtaaevtpireldnrtigggarg
    piteklqsaffdvvngksakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0gD (D:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgydeallld
    vdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekritrdevy
    tadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakhadwltki
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3u0gE (E:)
    mahhhhhhmgtleaqtqgpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfe
    gvrayktadggtaifrlkehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescyl
    rpiiwigseklgvsakgntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvr
    akasgwyvnsilanqeatadgydeallldvdgyvsegsgenfflvnrgklytpdlascld
    gitrdtvitlakeagieviekritrdevytadeafftgtaaevtpireldnrtigggarg
    piteklqsaffdvvngksakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0gE (E:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktaifrlkehtkrllns
    akifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihvaiaaw
    pwgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgydeallldvd
    gyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekritrdevyta
    deafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakhadwltk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3u0gF (F:)
    mahhhhhhmgtleaqtqgpgsmsmadrdgkiwmdgkliewrdakihvlthtlhygmgvfe
    gvrayktadggtaifrlkehtkrllnsakifqmdvpfdqetleaaqrdvvrenklescyl
    rpiiwigseklgvsakgntihvaiaawpwgaylgeeglakgirvktssftrhhvnvsmvr
    akasgwyvnsilanqeatadgydeallldvdgyvsegsgenfflvnrgklytpdlascld
    gitrdtvitlakeagieviekritrdevytadeafftgtaaevtpireldnrtigggarg
    piteklqsaffdvvngksakhadwltki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0gF (F:)
    smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
    rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
    aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
    deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
    itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
    dwltk