PDB entry 3tzm

View 3tzm on RCSB PDB site
Description: TGF-beta Receptor type 1 in complex with SB431542
Class: transferase/transferase inhibitor
Keywords: ALK5, SB431542, kinase domain, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-09-27, released 2012-05-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR1, ALK5, SKR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3tzma_
  • Heterogens: 085, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tzmA (A:)
    gamgstiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvml
    rhenilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasgla
    hlhmeivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvg
    tkrymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvps
    dpsveemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsq
    lsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzmA (A:)
    tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
    lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
    ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiaprvgtkrymap
    evlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsveem
    rkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqls