PDB entry 3ty7

View 3ty7 on RCSB PDB site
Description: Crystal Structure of Aldehyde Dehydrogenase family Protein from Staphylococcus aureus
Class: oxidoreductase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI, alpha-beta sandwich, cytosol, OXIDOREDUCTASE
Deposited on 2011-09-23, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aldehyde dehydrogenase SAV2122
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: SAV2122
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99SD6 (3-477)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ty7a1, d3ty7a2
  • Chain 'B':
    Compound: Putative aldehyde dehydrogenase SAV2122
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: SAV2122
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99SD6 (3-477)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ty7b1, d3ty7b2
  • Heterogens: GOL, PEG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ty7A (A:)
    snamrdytkqyingewvesnsnetievinpateevigkvakgnkadvdkaveaaddvyle
    frhtsvkerqalldkivkeyenrkddivqaitdelgaplslservhyqmglnhfvaarda
    ldnyefeerrgddlvvkeaigvsglitpwnfptnqtslklaaafaagspvvlkpseetpf
    aavilaeifdkvgvpkgvfnlvngdgagvgnplsehpkvrmmsftgsgptgskimekaak
    dfkkvslelggkspyivlddvdikeaakattgkvvnntgqvctagtrvlvpnkikdafla
    elkeqfsqvrvgnpredgtqvgpiiskkqfdqvqnyinkgieegaelfyggpgkpeglek
    gyfarptifinvdnqmtiaqeeifgpvmsvityndldeaiqiandtkyglagyvigkdke
    tlhkvarsieagtveineagrkpdlpfggykqsglgrewgdygieeflevksiagyfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty7A (A:)
    amrdytkqyingewvesnsnetievinpateevigkvakgnkadvdkaveaaddvylefr
    htsvkerqalldkivkeyenrkddivqaitdelgaplslservhyqmglnhfvaardald
    nyefeerrgddlvvkeaigvsglitpwnfptnqtslklaaafaagspvvlkpseetpfaa
    vilaeifdkvgvpkgvfnlvngdgagvgnplsehpkvrmmsftgsgptgsmekaakdfkk
    vslelggkspyivlddvdikeaakattgkvvnntgqvctagtrvlvpnkikdaflaelke
    qfsqvrvgnpredgtqvgpiiskkqfdqvqnyinkgieegaelfyggpgkpeglekgyfa
    rptifinvdnqmtiaqeeifgpvmsvityndldeaiqiandtkyglagyvigkdketlhk
    varsieagtveineaggieeflevksiagyfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ty7B (B:)
    snamrdytkqyingewvesnsnetievinpateevigkvakgnkadvdkaveaaddvyle
    frhtsvkerqalldkivkeyenrkddivqaitdelgaplslservhyqmglnhfvaarda
    ldnyefeerrgddlvvkeaigvsglitpwnfptnqtslklaaafaagspvvlkpseetpf
    aavilaeifdkvgvpkgvfnlvngdgagvgnplsehpkvrmmsftgsgptgskimekaak
    dfkkvslelggkspyivlddvdikeaakattgkvvnntgqvctagtrvlvpnkikdafla
    elkeqfsqvrvgnpredgtqvgpiiskkqfdqvqnyinkgieegaelfyggpgkpeglek
    gyfarptifinvdnqmtiaqeeifgpvmsvityndldeaiqiandtkyglagyvigkdke
    tlhkvarsieagtveineagrkpdlpfggykqsglgrewgdygieeflevksiagyfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty7B (B:)
    amrdytkqyingewvesnsnetievinpateevigkvakgnkadvdkaveaaddvylefr
    htsvkerqalldkivkeyenrkddivqaitdelgaplslservhyqmglnhfvaardald
    nyefeerrgddlvvkeaigvsglitpwnfptnqtslklaaafaagspvvlkpseetpfaa
    vilaeifdkvgvpkgvfnlvngdgagvgnplsehpkvrmmsftgsgptgskimekaakdf
    kkvslelggkspyivlddvdikeaakattgkvvnntgqvctagtrvlvpnkikdaflael
    keqfsqvrvgnpredgtqvgpiiskkqfdqvqnyinkgieegaelfyggpgkpeglekgy
    farptifinvdnqmtiaqeeifgpvmsvityndldeaiqiandtkyglagyvigkdketl
    hkvarsieagtveineaggieeflevksiagyfk