PDB entry 3ty6

View 3ty6 on RCSB PDB site
Description: ATP-dependent Protease HslV from Bacillus anthracis str. Ames
Class: hydrolase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta-beta-alpha sandwich, peotease, cytosol, HYDROLASE
Deposited on 2011-09-23, released 2011-10-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.166
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease subunit HslV
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS3681, BA_3968, GBAA_3968, hslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ty6a_
  • Chain 'B':
    Compound: ATP-dependent protease subunit HslV
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS3681, BA_3968, GBAA_3968, hslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ty6b_
  • Chain 'C':
    Compound: ATP-dependent protease subunit HslV
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS3681, BA_3968, GBAA_3968, hslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ty6c_
  • Chain 'D':
    Compound: ATP-dependent protease subunit HslV
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS3681, BA_3968, GBAA_3968, hslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ty6d_
  • Chain 'E':
    Compound: ATP-dependent protease subunit HslV
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS3681, BA_3968, GBAA_3968, hslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ty6e_
  • Chain 'F':
    Compound: ATP-dependent protease subunit HslV
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS3681, BA_3968, GBAA_3968, hslV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ty6f_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ty6A (A:)
    snamgnfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsv
    adaftlfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtg
    eviepddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiv
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty6A (A:)
    nfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaft
    lfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviep
    ddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ty6B (B:)
    snamgnfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsv
    adaftlfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtg
    eviepddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiv
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty6B (B:)
    nfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaft
    lfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviep
    ddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ty6C (C:)
    snamgnfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsv
    adaftlfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtg
    eviepddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiv
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty6C (C:)
    hattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaftlf
    emfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviepdd
    gilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ty6D (D:)
    snamgnfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsv
    adaftlfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtg
    eviepddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiv
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty6D (D:)
    nfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaft
    lfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviep
    ddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ty6E (E:)
    snamgnfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsv
    adaftlfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtg
    eviepddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiv
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty6E (E:)
    nfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaft
    lfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviep
    ddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ty6F (F:)
    snamgnfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsv
    adaftlfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtg
    eviepddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiv
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty6F (F:)
    nfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaft
    lfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviep
    ddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel