PDB entry 3ty0

View 3ty0 on RCSB PDB site
Description: Structure of PPARgamma ligand binding domain in complex with (R)-5-(3-((3-(6-methoxybenzo[d]isoxazol-3-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazol-1-yl)methyl)phenyl)-5-methyloxazolidine-2,4-dione
Class: transcription regulator
Keywords: nuclear receptor ligand binding domain, TRANSCRIPTION REGULATOR
Deposited on 2011-09-23, released 2011-11-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.236
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231
      • expression tag (0-1)
    Domains in SCOPe 2.02: d3ty0a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (2-276)
      • expression tag (0-1)
    Domains in SCOPe 2.02: d3ty0b_
  • Heterogens: 082, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ty0A (A:)
    gsqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmged
    kikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllky
    gvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleld
    dsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmt
    dlrqivtehvqllqvikktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ty0B (B:)
    gsqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmged
    kikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllky
    gvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleld
    dsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmt
    dlrqivtehvqllqvikktetdmslhpllqeiykdly