PDB entry 3txz

View 3txz on RCSB PDB site
Description: OYE1-W116Q complexed with R-carvone
Class: oxidoreductase
Keywords: Enantioselectivity, Alkene Reductase, Enone reductase, OYE Old yellow enzyme, TIM Barrel, NAD(P)H Oxidoreductase, Flavin mononucleotide, Nicotinamide adenine dinucleotide, OXIDOREDUCTASE
Deposited on 2011-09-23, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadph dehydrogenase 1
    Species: Saccharomyces pastorianus [TaxId:27292]
    Gene: OYE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02899 (Start-399)
      • engineered mutation (116)
    Domains in SCOPe 2.07: d3txza_
  • Heterogens: FMN, 07V, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3txzA (A:)
    msfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytq
    raqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlqvlg
    waafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakn
    siaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighek
    vglrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflte
    gegeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdr
    lekglplnkydrdtfyqmsahgyidyptyeealklgwdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3txzA (A:)
    sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
    aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlqvlgw
    aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
    iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
    glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
    egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
    ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk