PDB entry 3tx9

View 3tx9 on RCSB PDB site
Description: OYE1 complexed with 2-(Hydroxymethyl)-cyclopent-2-enone
Class: oxidoreductase
Keywords: OYE, Old yellow enzyme, flavin mononucleotide, NADPH, Baylis-hillman, alkene reductase, enone reductase, TIM barrel, NADPH Oxidoreductase, OXIDOREDUCTASE
Deposited on 2011-09-22, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadph dehydrogenase 1
    Species: Saccharomyces pastorianus [TaxId:27292]
    Gene: OYE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tx9a_
  • Heterogens: FMN, MG, 3RN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tx9A (A:)
    msfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytq
    raqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlwvlg
    waafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakn
    siaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighek
    vglrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflte
    gegeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdr
    lekglplnkydrdtfyqmsahgyidyptyeealklgwdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tx9A (A:)
    sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
    aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlwvlgw
    aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
    iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
    glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
    egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
    ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk