PDB entry 3tx7

View 3tx7 on RCSB PDB site
Description: Crystal structure of LRH-1/beta-catenin complex
Class: protein binding
Keywords: LRH-1, beta-catenin, Armadillo repeat, Nuclear Receptor Ligand Binding Domain, PROTEIN BINDING
Deposited on 2011-09-22, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catenin beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTNNB1, CTNNB, OK/SW-cl.35, PRO2286
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tx7a_
  • Chain 'B':
    Compound: Nuclear receptor subfamily 5 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR5A2, B1F, CPF, FTF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tx7b_
  • Heterogens: P6L

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tx7A (A:)
    snlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvs
    aivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyai
    ttlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliil
    asggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqr
    lvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkm
    mvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvk
    llhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggt
    qqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaag
    vlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tx7A (A:)
    latraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntnd
    vetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqe
    gakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvni
    mrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrn
    lsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggieal
    vrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwpli
    katvglirnlalcpanhaplreqgaiprlvqllvrahqdtqqfvegvrmeeivegctgal
    hilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegat
    apltellhsrnegvatyaaavlfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tx7B (B:)
    slkleamsqviqampsdltissaiqnihsaskglplnhaalpptdydrspfvtspismtm
    pphgslqgyqtyghfpsraikseypdpytsspesimgysymdsyqtsspasiphlilell
    kcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsivewarssiffrel
    kvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqagatlnnlms
    haqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaalldytmcny
    pqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlhakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tx7B (B:)
    asiphlilellkcepdepqvqakimaylqqeqaklstfglmckmadqtlfsivewarssq
    mkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqagatlnnlmshaqel
    vaklrslqfdqrefvclkflvlfsldvqlvegvqeqvnaalldytmcnypqqtekfgqll
    lrlpeiraismqaeeylyykhlngdvpynnlliemlha