PDB entry 3tw9

View 3tw9 on RCSB PDB site
Description: Crystal structure of gluconate dehydratase (TARGET EFI-501679) from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
Class: lyase
Keywords: enolase, magnesium binding site, lyase
Deposited on 2011-09-21, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.212
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative dehydratase
    Species: Salmonella enterica subsp. enterica serovar Enteritidis [TaxId:550537]
    Gene: SEN1436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tw9a1, d3tw9a2
  • Chain 'B':
    Compound: Putative dehydratase
    Species: Salmonella enterica subsp. enterica serovar Enteritidis [TaxId:550537]
    Gene: SEN1436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tw9b1, d3tw9b2
  • Chain 'C':
    Compound: Putative dehydratase
    Species: Salmonella enterica subsp. enterica serovar Enteritidis [TaxId:550537]
    Gene: SEN1436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tw9c1, d3tw9c2
  • Chain 'D':
    Compound: Putative dehydratase
    Species: Salmonella enterica subsp. enterica serovar Enteritidis [TaxId:550537]
    Gene: SEN1436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tw9d1, d3tw9d2
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tw9A (A:)
    mhhhhhhssgvdlgtenlyfqsmmkvsnlkitnvktiltapggidlavvkietnepglyg
    lgcatftqrifavksaideymapflvgkdptriediwqsgvvsgywrngpimnnalsgvd
    malwdikgklagmpvydllggkcrdgiplychtdggdevevednirarmeegyqyvrcqm
    gmyggagtddlkliatqlarakniqpkrsprsktpgiyfdpdayaksvprlfdhlrnklg
    fgiefihdvhervtpvtainlaktleqyqlfyledpvapenidwlkmlrqqsstpismge
    lfvnvnewkplidnrlidyirchvstiggitparklavyselngvrtawhgpgdispvgv
    canmhldlsspnfgiqeytpmndalrdvfpgcpeidhgyaylndkpglgidideakaaky
    pceggipswtmartpdgtasrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tw9A (A:)
    nlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapflvg
    kdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllggkcrdgi
    plychtdggdevevednirarmeegyqyvrcqmgmiqpkrsprsktpgiyfdpdayaksv
    prlfdhlrnklgfgiefihdvhervtpvtainlaktleqyqlfyledpvapenidwlkml
    rqqsstpismgelfvnvnewkplidnrlidyirchvstiggitparklavyselngvrta
    whgpgdispvgvcanmhldlsspnfgiqeytpmndalrdvfpgcpeidhgyaylndkpgl
    gidideakaakypceggipswtmartpdgtasrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tw9B (B:)
    mhhhhhhssgvdlgtenlyfqsmmkvsnlkitnvktiltapggidlavvkietnepglyg
    lgcatftqrifavksaideymapflvgkdptriediwqsgvvsgywrngpimnnalsgvd
    malwdikgklagmpvydllggkcrdgiplychtdggdevevednirarmeegyqyvrcqm
    gmyggagtddlkliatqlarakniqpkrsprsktpgiyfdpdayaksvprlfdhlrnklg
    fgiefihdvhervtpvtainlaktleqyqlfyledpvapenidwlkmlrqqsstpismge
    lfvnvnewkplidnrlidyirchvstiggitparklavyselngvrtawhgpgdispvgv
    canmhldlsspnfgiqeytpmndalrdvfpgcpeidhgyaylndkpglgidideakaaky
    pceggipswtmartpdgtasrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tw9B (B:)
    nlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapflvg
    kdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllggkcrdgi
    plychtdggdevevednirarmeegyqyvrcqmgmygdlkliatqlarakniqpkrsprs
    ktpgiyfdpdayaksvprlfdhlrnklgfgiefihdvhervtpvtainlaktleqyqlfy
    ledpvapenidwlkmlrqqsstpismgelfvnvnewkplidnrlidyirchvstiggitp
    arklavyselngvrtawhgpgdispvgvcanmhldlsspnfgiqeytpmndalrdvfpgc
    peidhgyaylndkpglgidideakaakypceggipswtmartpdgtasrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tw9C (C:)
    mhhhhhhssgvdlgtenlyfqsmmkvsnlkitnvktiltapggidlavvkietnepglyg
    lgcatftqrifavksaideymapflvgkdptriediwqsgvvsgywrngpimnnalsgvd
    malwdikgklagmpvydllggkcrdgiplychtdggdevevednirarmeegyqyvrcqm
    gmyggagtddlkliatqlarakniqpkrsprsktpgiyfdpdayaksvprlfdhlrnklg
    fgiefihdvhervtpvtainlaktleqyqlfyledpvapenidwlkmlrqqsstpismge
    lfvnvnewkplidnrlidyirchvstiggitparklavyselngvrtawhgpgdispvgv
    canmhldlsspnfgiqeytpmndalrdvfpgcpeidhgyaylndkpglgidideakaaky
    pceggipswtmartpdgtasrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tw9C (C:)
    nlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapflvg
    kdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllggkcrdgi
    plychtdggdevevednirarmeegyqyvrcqmgmniqpkrsprsktpgiyfdpdayaks
    vprlfdhlrnklgfgiefihdvhervtpvtainlaktleqyqlfyledpvapenidwlkm
    lrqqsstpismgelfvnvnewkplidnrlidyirchvstiggitparklavyselngvrt
    awhgpgdispvgvcanmhldlsspnfgiqeytpmndalrdvfpgcpeidhgyaylndkpg
    lgidideakaakypceggipswtmartpdgtasrp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tw9D (D:)
    mhhhhhhssgvdlgtenlyfqsmmkvsnlkitnvktiltapggidlavvkietnepglyg
    lgcatftqrifavksaideymapflvgkdptriediwqsgvvsgywrngpimnnalsgvd
    malwdikgklagmpvydllggkcrdgiplychtdggdevevednirarmeegyqyvrcqm
    gmyggagtddlkliatqlarakniqpkrsprsktpgiyfdpdayaksvprlfdhlrnklg
    fgiefihdvhervtpvtainlaktleqyqlfyledpvapenidwlkmlrqqsstpismge
    lfvnvnewkplidnrlidyirchvstiggitparklavyselngvrtawhgpgdispvgv
    canmhldlsspnfgiqeytpmndalrdvfpgcpeidhgyaylndkpglgidideakaaky
    pceggipswtmartpdgtasrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tw9D (D:)
    nlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapflvg
    kdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllggkcrdgi
    plychtdggdevevednirarmeegyqyvrcqmgmdlkliatqlarakniqpkrsprskt
    pgiyfdpdayaksvprlfdhlrnklgfgiefihdvhervtpvtainlaktleqyqlfyle
    dpvapenidwlkmlrqqsstpismgelfvnvnewkplidnrlidyirchvstiggitpar
    klavyselngvrtawhgpgdispvgvcanmhldlsspnfgiqeytpmndalrdvfpgcpe
    idhgyaylndkpglgidideakaakypceggipswtmartpdgtasrp