PDB entry 3tvq

View 3tvq on RCSB PDB site
Description: Crystal structure of TCM Aro/Cyc complexed with trans-dihidroquercetin
Class: transferase
Keywords: TETRACENOMYCIN, AROMATASE, CYCLASE, TAXIFOLIN, DIHYROQUERCETIN, Helix-grip fold, MULTIFUNCTIONAL CYCLASE-DEHYDRATASE-3-O-METHYL TRANSFERASE, TRANSFERASE
Deposited on 2011-09-20, released 2012-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.208
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multifunctional cyclase-dehydratase-3-O-methyl transferase tcmN
    Species: Streptomyces glaucescens [TaxId:1907]
    Gene: tcmN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tvqa_
  • Heterogens: DQH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tvqA (A:)
    maartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpdang
    rvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpgapf
    dnahmtahlntttranmerikkiiedrhregqrtpasvlptelhaqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tvqA (A:)
    maartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpdang
    rvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpgapf
    dnahmtahlntttranmerikkiiedrhregq