PDB entry 3tvd

View 3tvd on RCSB PDB site
Description: Crystal Structure of Mouse RhoA-GTP complex
Class: signaling protein
Keywords: Alpha helical, Protein_GTP complex, Helical protein, GTP binding protein, Regulates signal transduction pathway, GTP, Nil, Membrane, SIGNALING PROTEIN
Deposited on 2011-09-20, released 2012-10-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.228
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Arha, Arha2, Rhoa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tvda_
  • Chain 'B':
    Compound: transforming protein rhoa
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Arha, Arha2, Rhoa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tvdb_
  • Heterogens: GSP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tvdA (A:)
    maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    arrgkkksgclil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tvdA (A:)
    aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
    gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
    rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tvdB (B:)
    maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    arrgkkksgclil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tvdB (B:)
    aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
    gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
    rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa