PDB entry 3tv3

View 3tv3 on RCSB PDB site
Description: Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with Man9
Class: immune system
Keywords: Fab, HIV-1 neutralizing antibody, gp120, IMMUNE SYSTEM
Deposited on 2011-09-19, released 2011-10-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.159
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: PGT128 heavy chain, Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TV3 (0-134)
    • Uniprot P01857 (135-End)
  • Chain 'L':
    Compound: PGT128 light chain, Ig lambda-2 chain C regions
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLC2
    Database cross-references and differences (RAF-indexed):
    • PDB 3TV3 (Start-103)
    • Uniprot P0CG05 (105-End)
    Domains in SCOPe 2.03: d3tv3l1, d3tv3l2
  • Heterogens: GOL, AML, EPE, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >3tv3L (L:)
qsaltqppsasgspgqsitisctgtsnnfvswyqqhagkapklviydvnkrpsgvpdrfs
gsksgntasltvsglqtddeavyycgslvgnwdvifgggtkltvlgqpkaapsvtlfpps
seelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylslt
peqwkshrsyscqvthegstvektvaptecs

    Sequence, based on observed residues (ATOM records): (download) 
    >3tv3L (L:)
altqppsasgspgqsitisctgtsnnfvswyqqhagkapklviydvnkrpsgvpdrfsgs
ksgntasltvsglqtddeavyycgslvgnwdvifgggtkltvlgqpkaapsvtlfppsse
elqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpe
qwkshrsyscqvthegstvektvap