PDB entry 3ttz

View 3ttz on RCSB PDB site
Description: Crystal structure of a topoisomerase ATPase inhibitor
Class: isomerase/isomerase inhibitor
Keywords: protein-inhibitor complex, ATP-binding, structure-based drug design, antimicrobial, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2011-09-15, released 2011-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ttza_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ttzb_
  • Heterogens: 07N, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ttzA (A:)
    mygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievvie
    kdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykk
    gvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrd
    erdeenvredsyhyeggi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ttzA (A:)
    ygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviek
    dnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkg
    vpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrde
    rdeenvredsyhye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ttzB (B:)
    mygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievvie
    kdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykk
    gvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrd
    erdeenvredsyhyeggi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ttzB (B:)
    qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
    tdngrgipvdiqgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkev
    gttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvred
    syhye