PDB entry 3ttm

View 3ttm on RCSB PDB site
Description: Crystal structure of SpuD in complex with putrescine
Class: transport protein
Keywords: polyamine binding, putrescine, TRANSPORT PROTEIN
Deposited on 2011-09-15, released 2012-03-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyamine transport protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: spuD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ttma_
  • Chain 'B':
    Compound: Polyamine transport protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: spuD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ttmb_
  • Heterogens: PUT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ttmA (A:)
    gplgsdnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvv
    vpsnsflakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigy
    npdkvkaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdn
    pkelkaaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvt
    vkynipkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatp
    lvseairndpgiypseevmkklytfpdlpaktqramtrswtkiksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ttmA (A:)
    dnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvvvpsns
    flakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigynpdkv
    kaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdnpkelk
    aaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvtvkyni
    pkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatplvsea
    irndpgiypseevmkklytfpdlpaktqramtrswtkiksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ttmB (B:)
    gplgsdnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvv
    vpsnsflakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigy
    npdkvkaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdn
    pkelkaaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvt
    vkynipkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatp
    lvseairndpgiypseevmkklytfpdlpaktqramtrswtkiksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ttmB (B:)
    dnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvvvpsns
    flakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigynpdkv
    kaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdnpkelk
    aaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvtvkyni
    pkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatplvsea
    irndpgiypseevmkklytfpdlpaktqramtrswtkiksg