PDB entry 3ttk

View 3ttk on RCSB PDB site
Description: Crystal structure of apo-SpuD
Class: transport protein
Keywords: polyamine receptor, polyamine binding, TRANSPORT PROTEIN
Deposited on 2011-09-14, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: 0.219
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyamine transport protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: spuD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ttka_
  • Chain 'B':
    Compound: Polyamine transport protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: spuD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ttkb_
  • Chain 'C':
    Compound: Polyamine transport protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: spuD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ttkc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ttkA (A:)
    gplgsdnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvv
    vpsnsflakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigy
    npdkvkaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdn
    pkelkaaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvt
    vkynipkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatp
    lvseairndpgiypseevmkklytfpdlpaktqramtrswtkiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ttkA (A:)
    dnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvvvpsns
    flakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigynpdkv
    kaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdnpkelk
    aaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvtvkyni
    pkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatplvsea
    irndpgiypseevmkklytfpdlpaktqramtrswtkiks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ttkB (B:)
    gplgsdnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvv
    vpsnsflakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigy
    npdkvkaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdn
    pkelkaaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvt
    vkynipkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatp
    lvseairndpgiypseevmkklytfpdlpaktqramtrswtkiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ttkB (B:)
    dnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvvvpsns
    flakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigynpdkv
    kaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdnpkelk
    aaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvtvkyni
    pkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatplvsea
    irndpgiypseevmkklytfpdlpaktqramtrswtkiks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ttkC (C:)
    gplgsdnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvv
    vpsnsflakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigy
    npdkvkaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdn
    pkelkaaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvt
    vkynipkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatp
    lvseairndpgiypseevmkklytfpdlpaktqramtrswtkiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ttkC (C:)
    dnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvvvpsns
    flakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigynpdkv
    kaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdnpkelk
    aaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvtvkyni
    pkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatplvsea
    irndpgiypseevmkklytfpdlpaktqramtrswtkiks